<?xml version="1.0"?>
<?xml-stylesheet type="text/css" href="http://www.phosphatome.net/wiki/skins/common/feed.css?303"?>
<feed xmlns="http://www.w3.org/2005/Atom" xml:lang="en">
		<id>http://www.phosphatome.net/wiki/api.php?action=feedcontributions&amp;feedformat=atom&amp;user=Mark</id>
		<title>PhosphataseWiki - User contributions [en]</title>
		<link rel="self" type="application/atom+xml" href="http://www.phosphatome.net/wiki/api.php?action=feedcontributions&amp;feedformat=atom&amp;user=Mark"/>
		<link rel="alternate" type="text/html" href="http://www.phosphatome.net/wiki/index.php/Special:Contributions/Mark"/>
		<updated>2026-06-10T00:48:22Z</updated>
		<subtitle>User contributions</subtitle>
		<generator>MediaWiki 1.22.4</generator>

	<entry>
		<id>http://www.phosphatome.net/wiki/index.php/HMM_PD00171</id>
		<title>HMM PD00171</title>
		<link rel="alternate" type="text/html" href="http://www.phosphatome.net/wiki/index.php/HMM_PD00171"/>
				<updated>2017-03-15T18:30:41Z</updated>
		
		<summary type="html">&lt;p&gt;Mark: Created page with &amp;quot;Back to '''List of HMMs'''  '''Symbol''': RA  '''Name''': Ras Association   === Why built the HMM ===  Human PHLPPs have RA domains, but they are not found by Pfam, SM...&amp;quot;&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Back to '''[[HMM|List of HMMs]]'''&lt;br /&gt;
&lt;br /&gt;
'''Symbol''': RA&lt;br /&gt;
&lt;br /&gt;
'''Name''': Ras Association &lt;br /&gt;
&lt;br /&gt;
=== Why built the HMM ===&lt;br /&gt;
&lt;br /&gt;
Human PHLPPs have RA domains, but they are not found by Pfam, SMART or CDD. That motivates us to build a HMM.&lt;br /&gt;
&lt;br /&gt;
=== How the HMM was built ===&lt;/div&gt;</summary>
		<author><name>Mark</name></author>	</entry>

	<entry>
		<id>http://www.phosphatome.net/wiki/index.php/HMM</id>
		<title>HMM</title>
		<link rel="alternate" type="text/html" href="http://www.phosphatome.net/wiki/index.php/HMM"/>
				<updated>2017-03-15T18:26:06Z</updated>
		
		<summary type="html">&lt;p&gt;Mark: /* HMMs of accessory domains */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;We use HMMs to detect phosphatase domains and accessory domains. We benefit from the HMMs in public database such as Pfam, and the sequence alignments from public database such as CDD, SMART and COG, which are useful to build HMMs. We also build HMMs from scratch. &lt;br /&gt;
&lt;br /&gt;
== HMMs for Determining the Boundaries of Protein Phosphatase Domain ==&lt;br /&gt;
* CC1 Fold&lt;br /&gt;
** [[HMM_PD0002|DSP]]&lt;br /&gt;
** [[HMM_PD0003|Myotubularin]]&lt;br /&gt;
** [[HMM_PD0004|OCA]]&lt;br /&gt;
** [[HMM_PD0005|PTEN]]&lt;br /&gt;
** [[HMM_PD0006|PTP]]&lt;br /&gt;
** [[HMM_PD0007|Paladin]]&lt;br /&gt;
** [[HMM_PD0008|Sac]] &lt;br /&gt;
&lt;br /&gt;
* CC2 fold&lt;br /&gt;
** [[HMM_PD0009|LMWPTP]] &lt;br /&gt;
** [[HMM_PD0010|SSU72]]&lt;br /&gt;
&lt;br /&gt;
* [[HMM_PD0021|CC3/Rhodanese/CDC25]]&lt;br /&gt;
&lt;br /&gt;
* HAD fold&lt;br /&gt;
** [[HMM_PD0011|EYA]]&lt;br /&gt;
** [[HMM_PD0012|FCP]] &lt;br /&gt;
** [[HMM_PD0013|NagD]] &lt;br /&gt;
&lt;br /&gt;
* HP fold&lt;br /&gt;
** [[HMM_PD0014|HP1]]&lt;br /&gt;
** [[HMM_PD0015|HP2]]&lt;br /&gt;
&lt;br /&gt;
* PPP fold&lt;br /&gt;
** [[HMM_PD0018|PAP]]&lt;br /&gt;
** [[HMM_PD0019|PPP]]&lt;br /&gt;
&lt;br /&gt;
* [[HMM_PD0001|AP fold]]&lt;br /&gt;
&lt;br /&gt;
* [[HMM_PD0016|PHP fold]]&lt;br /&gt;
&lt;br /&gt;
* [[HMM_PD0017|PPM fold]]&lt;br /&gt;
&lt;br /&gt;
* [[HMM_PD0020|RTR1 fold]]&lt;br /&gt;
&lt;br /&gt;
== HMMs for Finding Protein Phosphatase Domain with High Coverage ==&lt;br /&gt;
We have built a semi-redundant HMM profiles to detect phosphatase domains from biological sequences. We first used the HMMs from public databases, Pfam, SMART and SUPERFAMILY to search protein phosphatases we collected from the literature. We found 1) the HMMs from public databases such as Pfam and SMART can not find all human protein phosphatases, 2) some HMMs are redundant, - they captured exactly the same set of protein phosphatases. Thus, we 1) build in-house HMMs to capture the human protein phosphatases missed, 2) remove 100% redundant HMMs. You can [http://phosphatome.net/download/ download the HMMs].&lt;br /&gt;
&lt;br /&gt;
* [[HMM_PD00156|Vertebrate PTP]]: built from the alignment of 195 vertebrate PTP sequences at [http://ptp.cshl.edu/downloads.shtml ptp.cshl].&lt;br /&gt;
&lt;br /&gt;
== HMMs of accessory domains ==&lt;br /&gt;
* [[HMM_CA00001|PH domain]]&lt;br /&gt;
** [[HMM_PD0134|MTMR_GRAM]]: myotubularin, GRAM domain (in-house)&lt;br /&gt;
*** [[HMM_PD00135|MTMR_1_GRAM]]: GRAM domain profile of MTMR1, MTMR5, MTMR6, MTMR9 and MTMR10 subfamilies (in-house)&lt;br /&gt;
*** [[HMM_PD00136|MTMR3_GRAM]]:  MTMR3, GRAM domain (in-house)&lt;br /&gt;
*** [[HMM_PD00152|MTMR9_GRAM]]: MTMR9, GRAM domain (built from CDD alignment)&lt;br /&gt;
*** [[HMM_PD00137|MTMR14_GRAM]]: MTMR14, GRAM domain (in-house)&lt;br /&gt;
** [[HMM_PD0149|PH_1]]: PH domain (built from CDD alignment)&lt;br /&gt;
&lt;br /&gt;
* FCP1 C-Terminal Domain: FCP1 has a C-terminal domain which is conserved in individual clades such as vertebrates and arthropods. However, it is hard to built a universal profile to capture all the FCP1 CTD. The best guess is that the region contains several short motifs.&lt;br /&gt;
** [[HMM_PD00155|FCP1_CTD]]: FCP1, C-Terminal Domain (in-house). The profile aims at to detect the presence of FCP1_C domain but not the boundaries. The profile is able to detect FCP1 CTD in eumetazoa, such as nematostella, fruit fly, some but not all nematodes (e.g. Loa loa), sea urchin, Ciona and human.&lt;br /&gt;
&lt;br /&gt;
* [[HMM_PD00154|VSP_VSD]]: VSP, Voltage Sensor Domain (in-house)&lt;br /&gt;
&lt;br /&gt;
* [[HMM_PD0127|PAP_NTD]]: Purple Acid Phosphatase, N-Terminal Domain (in-house)&lt;br /&gt;
&lt;br /&gt;
* [[HMM_PD0128|CDC25_NTD]]: CDC25, N-terminal domain (in-house)&lt;br /&gt;
&lt;br /&gt;
* [[HMM_PD0129|IQ]]: IQ profile built from SMART alignment &lt;br /&gt;
&lt;br /&gt;
* [[HMM_PD0130|PPIP5K_RimK]]&lt;br /&gt;
&lt;br /&gt;
* [[HMM_PD0131|STS_UBA]]&lt;br /&gt;
&lt;br /&gt;
* [[HMM_PD0133|MTMR5_C1]]: MTMR5, C1 domain (in-house)&lt;br /&gt;
&lt;br /&gt;
* [[HMM_PD0139|SacN]]: Sac N-terminal domain (in-house)&lt;br /&gt;
&lt;br /&gt;
* [[HMM_PD0144|IPPc]]: Inositol Polyphosphate Phosphatase, catalytic domain homologues (built from SMART alignment)&lt;br /&gt;
&lt;br /&gt;
* [[HMM_PD0145|SAC9_CTD1]]: SAC9 C-terminal domain 1. The domain is mostly found in plants, green algae, and amoebazoa. (in-house)&lt;br /&gt;
&lt;br /&gt;
* [[HMM_PD0146|SAC9_CTD2]]: SAC9 C-terminal domain 2. The domain is mostly found in plants, green algae, and amoebazoa.  (in-house)&lt;br /&gt;
&lt;br /&gt;
* [[HMM_PD0147|WW]] (built from SMART alignment)&lt;br /&gt;
&lt;br /&gt;
* [[HMM_PD0148|SSH_NTD]]: Slingshot, N-terminal domain (built from CDD alignment)&lt;br /&gt;
&lt;br /&gt;
* [[HMM_PD00151|DnaJ_1]]: DnaJ domain (built from SMART alignment)&lt;br /&gt;
&lt;br /&gt;
* [[HMM_PD00171|RA]]: Ras Association (RA)&lt;br /&gt;
&lt;br /&gt;
== HMMs partially overlap with phosphatase domains ==&lt;br /&gt;
Some domains and their HMM profiles partially over with phosphatase domains. We do not consider them as accessory domains.&lt;br /&gt;
&lt;br /&gt;
* [http://pfam.xfam.org/family/PF07830.9 PP2C_C]: Pfam HMM specifically matches with PPP1C but not other PPP subfamilies. The Pfam PP2C_C profile only matches the PPP1C subfamily. It overlaps with our in-house PPP HMM profile.&lt;br /&gt;
&lt;br /&gt;
* [http://pfam.xfam.org/family/3-PAP#tabview=tab1 3-PAP]: The Pfam 3-PAP domain has poor quality. As described on the domain &amp;quot;this domain family is found in eukaryotes, and is typically between 115 and 138 amino acids in length&amp;quot;. But, it has a length of 132 aa in HMM logo. The profile partially overlaps with our profile of myotubularin phosphatase domain, whose boundaries are determined from crystal structure.&lt;br /&gt;
&lt;br /&gt;
== Guidance for HMM building ==&lt;br /&gt;
We usually built the HMMs from PSI-BLAST hits. &lt;br /&gt;
&lt;br /&gt;
To find the domain sequences for building a HMM, we PSI-BLASTed the domain sequence or the full sequence usually against protein NR/RefSeq/Swiss-Prot dataset via NCBI BLAST server. It sometime matters if you query the region that is supposed to contain the domain (based upon structure or any evidence) or the full sequence. The full sequence is often more sensitive to find weak hits to the domain. We recommended to download the files of Alignment, Search Strategies, and PssmWithParameters of PSI-BLAST result for reproductivity. The boundaries of the domain are determined by crystal structures, usually using the boundaries described in the papers reported the structures.&lt;br /&gt;
&lt;br /&gt;
After several rounds of PSI-BLAST, we download the sequences of the aligned regions (not the complete sequences) from PSI-BLAST result. Because some sequences are redundant, which are not useful to build the HMM profile, we create the non-redundant sequence data set by using program [http://weizhong-lab.ucsd.edu/cdhit_suite/cgi-bin/index.cgi CD-HIT] (usually with sequence identity threshold as 70%, i.e. the parameter -c is set as 0.7). &lt;br /&gt;
&lt;br /&gt;
We then carry out multiple sequence alignment (MSA) using programs such as [http://www.drive5.com/muscle/ MUSCLE], manually adjust the alignment usually by removing low-quality region in MSA editor such as [http://www.jalview.org JalView]. We further inspect the distribution of sequence lengths in the MSA and remove the sequences which are shorter than most sequences in the MSA. How we remove the short sequences is dependent on the distribution and the MSA itself, which varies case by case. &lt;br /&gt;
&lt;br /&gt;
We carry out MSA program and manually adjust the resulted MSA again after remove the short sequences. Then, we build HMM using program [http://hmmer.janelia.org HMMBUILD]. Depending on the format you use, you may need to [http://sequenceconversion.bugaco.com/converter/biology/sequences/fasta_to_stockholm.php convert the MSA into STOCKHOLM format] before running HMMBUILD.&lt;br /&gt;
&lt;br /&gt;
Note: The conserved regions (determined by sequence similarity) could be longer or shorter than the domains observed in crystal structures.&lt;/div&gt;</summary>
		<author><name>Mark</name></author>	</entry>

	<entry>
		<id>http://www.phosphatome.net/wiki/index.php/Phosphatase_Subfamily_PHLPP</id>
		<title>Phosphatase Subfamily PHLPP</title>
		<link rel="alternate" type="text/html" href="http://www.phosphatome.net/wiki/index.php/Phosphatase_Subfamily_PHLPP"/>
				<updated>2017-03-09T19:38:13Z</updated>
		
		<summary type="html">&lt;p&gt;Mark: /* PH domain of PHLPP */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;__NOTOC__&lt;br /&gt;
[[Phosphatase classification|Phosphatase Classification]]: [[Phosphatase_Fold_PPM|Fold PPM]]: [[Phosphatase_Superfamily_PPM|Superfamily PPM]]: [[Phosphatase_Family_PPM|Family PPM]]: [[Phosphatase_Subfamily_PHLPP|Subfamily PHLPP]]&lt;br /&gt;
&lt;br /&gt;
PHLPP (PH domain leucine-rich repeat protein phosphatases) phosphatases regulate Akt, PKC and other AGC kinases through dephosphorylation of their hydrophobic motifs&lt;br /&gt;
&lt;br /&gt;
=== Evolution ===&lt;br /&gt;
The PHLPP subfamily is found across bilateria. Human has two members, PHLPP1/SCOP andPHLPP2, which most likely originated from vertebrate whole genome duplication. A likely homolog exists in fungi, where it is fused to adenylate cyclase. In Saccharomyces CYR1, it is the only adenylate cylcase gene in the genome.&lt;br /&gt;
&lt;br /&gt;
=== Domain ===&lt;br /&gt;
The PHLPP subfamily has a N-terminal putative ras-binding domain (RBD), followed by a PH domain, several leucine rich repeats, a phosphatase domain, and (in vertebates) a C-terminal PDZ-domain binding motif. Ecdysozoa (e.g. Drosophila and Caenorhabditis) have a divergent PH domain that scores poorly on HMM or PSSM profiles from public databases (see [[Phosphatase_Subfamily_PHLPP#PH_domain_of_PHLPP|technical note]]), and Muscomorpha, including Drosophila, have lost the PH and RBD, while within nematodes, Caenorhabditids have also lost the RBD.&lt;br /&gt;
&lt;br /&gt;
=== Functions ===&lt;br /&gt;
PHLPP dephosphorylates [http://kinase.com/wiki/index.php/Kinase_Group_AGC AGC group] kinases at serines in their hydrophobic motif, in particular members of the Akt and PKC families.&lt;br /&gt;
&lt;br /&gt;
* PHLPP1 and PHLPP2 dephosphorylate and inactivate Akt kinases  at Ser-473 of human AKT1 &amp;lt;cite&amp;gt;Gao05, Brognard07&amp;lt;/cite&amp;gt;. PHLPP1 prefers to dephosphorylate AKT2 and PHLPP2 prefers AKT3 &amp;lt;cite&amp;gt;Brognard07&amp;lt;/cite&amp;gt;. The position Ser-473 located in the hydrophobic motif is conserved across bilateria and among the three human members. It is also found in one sponge AKT, but absent from other sponge AKTs (see [http://kinase.com/web/current/kinbase/genes/Family/Akt/alignment/protein/view alignment in KinBase]).&lt;br /&gt;
&lt;br /&gt;
* PHLPP also dephosphorylates PKC at Ser-660 of human PKC-beta &amp;lt;cite&amp;gt;Gao08&amp;lt;/cite&amp;gt;, also in the hydrophobic motif. This motif is conserved across metazoa (replaced by Thr in sea urchin) (see [http://kinase.com/web/current/kinbase/genes/Subfamily/PKCa/alignment/protein/view KinBase]).&lt;br /&gt;
&lt;br /&gt;
* PHLPP also dephosphorylates S6 kinase &amp;lt;cite&amp;gt;Liu11&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
Loss of PHLPP can increase the level of phosphorylated [http://en.wikipedia.org/wiki/Survivin Survivin], a member of the inhibitor of apoptosis (IAP) family, in gallbladder carcinoma (GBC) cells &amp;lt;cite&amp;gt;Qiu15&amp;lt;/cite&amp;gt;. But, it is unclear whether PHLPP directly dephosphorylates Survivin.&lt;br /&gt;
&lt;br /&gt;
PHLPP1 and PHLPP2 are implicated in different kinds of cancers, including colon cancer &amp;lt;cite&amp;gt;Liu09&amp;lt;/cite&amp;gt; and hypopharyngeal squamous cell carcinomas &amp;lt;cite&amp;gt;Zhou15&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
=== References ===&lt;br /&gt;
&amp;lt;biblio&amp;gt;&lt;br /&gt;
#Gao05 pmid=15808505&lt;br /&gt;
#Brognard07 pmid=17386267&lt;br /&gt;
#Gao08 pmid=18162466&lt;br /&gt;
#Liu09 pmid=19079341&lt;br /&gt;
#Liu11 pmid=21986499&lt;br /&gt;
#Qiu15 pmid=25895131&lt;br /&gt;
#Zhou15 pmid=25793736&lt;br /&gt;
&amp;lt;/biblio&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=== Technical notes ===&lt;br /&gt;
===== PH domain of PHLPP =====&lt;br /&gt;
PHLPPs of deuterostomes (e.g. human) and lophotrochozoa have the PH domain, as detected by HMM or PSSM profiles from Pfam and/or NCBI CDD database. However, we cannot find PH domain in PHLPPs of most ecdysozoa (e.g. Drosophila and Caenorhabditis). When PSI-BLASTing the full sequence of human PHLPP, we found the PH domain in ''Loa loa'' PHLPP. We then PSI-BLASTed the PH domain in ''Loa loa'' PHLPP and found the PH domains in other nematode PHLPPs. However, we do not find the hits from arthropods. &lt;br /&gt;
&lt;br /&gt;
We looked in the domain combination of Drosophila melanogaster PHLPP, which has LRRs and phosphatase domains started from ~100 aa. Because the PH domain is adjacent to LRRs on the N-terminal side, we therefore hypothesized there might a PH domain located somewhere from 1 to 100 aa. We PSI-BLASTed the region and found weak hits toward LRR region but not PH region of human PHLPP2. Thus, our best guess is that PH domain is absent from arthropod PHLPP.&lt;/div&gt;</summary>
		<author><name>Mark</name></author>	</entry>

	<entry>
		<id>http://www.phosphatome.net/wiki/index.php/Phosphatase_GeneID_AqueP052</id>
		<title>Phosphatase GeneID AqueP052</title>
		<link rel="alternate" type="text/html" href="http://www.phosphatome.net/wiki/index.php/Phosphatase_GeneID_AqueP052"/>
				<updated>2017-02-23T20:23:52Z</updated>
		
		<summary type="html">&lt;p&gt;Mark: Created page with &amp;quot;Merged into AqueP053.&amp;quot;&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Merged into AqueP053.&lt;/div&gt;</summary>
		<author><name>Mark</name></author>	</entry>

	<entry>
		<id>http://www.phosphatome.net/wiki/index.php/Phosphatase_GeneID_SpurP099</id>
		<title>Phosphatase GeneID SpurP099</title>
		<link rel="alternate" type="text/html" href="http://www.phosphatome.net/wiki/index.php/Phosphatase_GeneID_SpurP099"/>
				<updated>2017-02-23T20:18:38Z</updated>
		
		<summary type="html">&lt;p&gt;Mark: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Merged into SpurP098.&lt;/div&gt;</summary>
		<author><name>Mark</name></author>	</entry>

	<entry>
		<id>http://www.phosphatome.net/wiki/index.php/Phosphatase_GeneID_SpurP099</id>
		<title>Phosphatase GeneID SpurP099</title>
		<link rel="alternate" type="text/html" href="http://www.phosphatome.net/wiki/index.php/Phosphatase_GeneID_SpurP099"/>
				<updated>2017-02-23T20:18:31Z</updated>
		
		<summary type="html">&lt;p&gt;Mark: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Merge into SpurP098.&lt;/div&gt;</summary>
		<author><name>Mark</name></author>	</entry>

	<entry>
		<id>http://www.phosphatome.net/wiki/index.php/Phosphatase_GeneID_SpurP101</id>
		<title>Phosphatase GeneID SpurP101</title>
		<link rel="alternate" type="text/html" href="http://www.phosphatome.net/wiki/index.php/Phosphatase_GeneID_SpurP101"/>
				<updated>2017-02-23T20:18:17Z</updated>
		
		<summary type="html">&lt;p&gt;Mark: Created page with &amp;quot;Merged into SpurP098.&amp;quot;&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Merged into SpurP098.&lt;/div&gt;</summary>
		<author><name>Mark</name></author>	</entry>

	<entry>
		<id>http://www.phosphatome.net/wiki/index.php/Phosphatase_GeneID_SpurP099</id>
		<title>Phosphatase GeneID SpurP099</title>
		<link rel="alternate" type="text/html" href="http://www.phosphatome.net/wiki/index.php/Phosphatase_GeneID_SpurP099"/>
				<updated>2017-02-23T20:17:52Z</updated>
		
		<summary type="html">&lt;p&gt;Mark: Created page with &amp;quot;Merge with SpurP098.&amp;quot;&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Merge with SpurP098.&lt;/div&gt;</summary>
		<author><name>Mark</name></author>	</entry>

	<entry>
		<id>http://www.phosphatome.net/wiki/index.php/Phosphatase_Subfamily_PTPN6</id>
		<title>Phosphatase Subfamily PTPN6</title>
		<link rel="alternate" type="text/html" href="http://www.phosphatome.net/wiki/index.php/Phosphatase_Subfamily_PTPN6"/>
				<updated>2017-01-07T20:36:53Z</updated>
		
		<summary type="html">&lt;p&gt;Mark: /* References */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;__NOTOC__&lt;br /&gt;
[[Phosphatase classification|Phosphatase Classification]]: [[Phosphatase_Fold_CC1|Fold CC1]]:[[Phosphatase_Superfamily_CC1|Superfamily CC1]]: [[Phosphatase_Family_PTP|Family PTP]]: [[Phosphatase_Subfamily_PTPN6|Subfamily PTPN6]] (SHP/SHIP/csw/Corkscrew)&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
The PTPN6 subfamily is found across holozoa. It is a single copy in most invertebrate genomes and two or three copies in most vertebrates. Human has two members, PTPN6 (SHP1) and PTPN11 (SHP2).&lt;br /&gt;
&lt;br /&gt;
===Domain ===&lt;br /&gt;
The PTPN6 subfamily has two tandem SH2 domains and phosphatase domain. Besides the structural domains, it has a C-terminal tail important for the regulation of its function &amp;lt;cite&amp;gt;Poole05&amp;lt;/cite&amp;gt;.  For example, PTPN11 (SHP2) has a carboxy-terminal immunoreceptor tyrosine-based activation motif (ITAM) &amp;lt;cite&amp;gt;Deng15&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
The genes of PTPN6 subfamily have multiple alternative splicing isoforms, which may result in different domain combinations. For instance, the longest isoform of Drosophila genus do not have the first SH2 domain (technical notes: the longest isoforms in [http://ensemblgenomes.org Ensembl genomes]).&lt;br /&gt;
&lt;br /&gt;
===Functions===&lt;br /&gt;
Human PTPN6 (SHP1) and PTPN11 (SHP2) are proposed to have different roles in signal transduction: PTPN6 plays a largely negative signalling role, whereas PTPN11 plays a largely positive role in cell signalling leading to cell activation. Expression of PTPN6 is restricted mainly to haematopoietic cells whereas PTPN11 is more widely expressed; both enzymes are expressed in many haematopoietic cells &amp;lt;cite&amp;gt;Poole05&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
The PTPN6 subfamiy is extensively studied and reviewed (e.g. &amp;lt;cite&amp;gt;Neel03, Lorenz09&amp;lt;/cite&amp;gt;). Below are some examples of their functions:&lt;br /&gt;
&lt;br /&gt;
===== PTPN6/SHP1 =====&lt;br /&gt;
PTPN6/SHP-1 dephosphorylates and inhibites Transient receptor potential vanilloid 1 (TRPV1) receptors in rat dorsal root ganglions (DRGs) &amp;lt;cite&amp;gt;Xiao15&amp;lt;/cite&amp;gt;. [http://en.wikipedia.org/wiki/TRPV1 TRPV1] is a nonselective cation channel that provides sensation of scalding heat and pain (nociception).&lt;br /&gt;
&lt;br /&gt;
The bacterial pathogen Bordetella pertussis can hijack PTPN6 (SHP-1) by the adenylate cyclase toxin-hemolysin (CyaA). CyaA penetrates complement receptor 3-expressing phagocytes and catalyzes uncontrolled conversion of cytosolic ATP to the key second messenger molecule cAMP.  CyaA/cAMP signaling induced SHP phosphatase-dependent dephosphorylation of the c-Fos subunit of the transcription factor AP-1, therefore inhibiting TLR4-triggered induction of iNOS gene expression and suppressing production of bactericidal NO in macrophage cells &amp;lt;cite&amp;gt;Cerny15&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
PTPN6 expression by NK cells is required for in vivo-mismatched bone marrow allograft rejection as well as for NK memory responses to happen &amp;lt;cite&amp;gt;Gumbleton15&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===== PTPN11/SHP2 =====&lt;br /&gt;
PTPN11 is a major player in receptor tyrosine kinase signaling to Ras, by a variety of mechanisms.&lt;br /&gt;
&lt;br /&gt;
PKA phosphorylates PTPN11/SHP-2 at Thr-73 and Ser-189 in two SH2 domains, respectively. The phosphorylation inhibits ligand-binding mediated by SH2 domains and phosphatase activity &amp;lt;cite&amp;gt;Burmeister15&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
PTPN11/SHP-2 acts as a regulator of the tyrosyl phosphorylation of FGFR4 and of its immediate target FRS2α, thus being essential for the FGF15/19-mediated activation of the FGFR4/P-ERK1/2/PKC signaling pathway as a integrator of hepatic [http://en.wikipedia.org/wiki/Bile_acid bile acid] and FGF15/FGF19 signaling &amp;lt;cite&amp;gt;Perino14&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
A PTPN11 allele encoding a catalytically impaired protein was found in a patient with a Noonan syndrome phenotype &amp;lt;cite&amp;gt;Edwards14&amp;lt;/cite&amp;gt;. But, it is unclear whether PTPN11 is a general casuative gene of Noonan syndrome.&lt;br /&gt;
&lt;br /&gt;
PTPN11 (SHP-2) can operate as a scaffold, facilitating the recruitment of kinase Syk to the CLR dectin-1 or the adaptor FcRγ, through its N-SH2 domain and a carboxy-terminal immunoreceptor tyrosine-based activation motif (ITAM) &amp;lt;cite&amp;gt;Deng15&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
PTPN11 (SHP-2) promotes liver cancer stem cell expansion by augmenting β-catenin signaling and predicts chemotherapeutic response of patients &amp;lt;cite&amp;gt;Xiang2017&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===== Drosophila Corkscrew (csw) =====&lt;br /&gt;
Drosophila has a single gene of PTPN6 subfamily, corkscrew (csw). It binds to and dephosphorylates Draper-II, an alternative splice variant of Draper &amp;lt;cite&amp;gt;Logan12&amp;lt;/cite&amp;gt;, which is orthologous to human [http://www.ncbi.nlm.nih.gov/gene/84465 MEGF11] (multiple EGF-like-domains 11).&lt;br /&gt;
&lt;br /&gt;
===References===&lt;br /&gt;
&amp;lt;biblio&amp;gt;&lt;br /&gt;
#Burmeister15 pmid=25802336&lt;br /&gt;
#Cerny15 pmid=25876760&lt;br /&gt;
#Deng15 pmid=25915733&lt;br /&gt;
#Edwards14 pmid=24891296&lt;br /&gt;
#Gumbleton15 pmid=25687756&lt;br /&gt;
#Logan12 pmid=22426252&lt;br /&gt;
#Lorenz09 pmid=19290938&lt;br /&gt;
#Neel03 pmid=12826400&lt;br /&gt;
#Perino14 pmid=25100060&lt;br /&gt;
#Poole05 pmid=16084691&lt;br /&gt;
#Xiang2017 pmid=28059452&lt;br /&gt;
#Xiao15 pmid=25790452&lt;br /&gt;
&amp;lt;/biblio&amp;gt;&lt;/div&gt;</summary>
		<author><name>Mark</name></author>	</entry>

	<entry>
		<id>http://www.phosphatome.net/wiki/index.php/Phosphatase_Subfamily_PTPN6</id>
		<title>Phosphatase Subfamily PTPN6</title>
		<link rel="alternate" type="text/html" href="http://www.phosphatome.net/wiki/index.php/Phosphatase_Subfamily_PTPN6"/>
				<updated>2017-01-07T20:36:24Z</updated>
		
		<summary type="html">&lt;p&gt;Mark: /* PTPN11/SHP2 */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;__NOTOC__&lt;br /&gt;
[[Phosphatase classification|Phosphatase Classification]]: [[Phosphatase_Fold_CC1|Fold CC1]]:[[Phosphatase_Superfamily_CC1|Superfamily CC1]]: [[Phosphatase_Family_PTP|Family PTP]]: [[Phosphatase_Subfamily_PTPN6|Subfamily PTPN6]] (SHP/SHIP/csw/Corkscrew)&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
The PTPN6 subfamily is found across holozoa. It is a single copy in most invertebrate genomes and two or three copies in most vertebrates. Human has two members, PTPN6 (SHP1) and PTPN11 (SHP2).&lt;br /&gt;
&lt;br /&gt;
===Domain ===&lt;br /&gt;
The PTPN6 subfamily has two tandem SH2 domains and phosphatase domain. Besides the structural domains, it has a C-terminal tail important for the regulation of its function &amp;lt;cite&amp;gt;Poole05&amp;lt;/cite&amp;gt;.  For example, PTPN11 (SHP2) has a carboxy-terminal immunoreceptor tyrosine-based activation motif (ITAM) &amp;lt;cite&amp;gt;Deng15&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
The genes of PTPN6 subfamily have multiple alternative splicing isoforms, which may result in different domain combinations. For instance, the longest isoform of Drosophila genus do not have the first SH2 domain (technical notes: the longest isoforms in [http://ensemblgenomes.org Ensembl genomes]).&lt;br /&gt;
&lt;br /&gt;
===Functions===&lt;br /&gt;
Human PTPN6 (SHP1) and PTPN11 (SHP2) are proposed to have different roles in signal transduction: PTPN6 plays a largely negative signalling role, whereas PTPN11 plays a largely positive role in cell signalling leading to cell activation. Expression of PTPN6 is restricted mainly to haematopoietic cells whereas PTPN11 is more widely expressed; both enzymes are expressed in many haematopoietic cells &amp;lt;cite&amp;gt;Poole05&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
The PTPN6 subfamiy is extensively studied and reviewed (e.g. &amp;lt;cite&amp;gt;Neel03, Lorenz09&amp;lt;/cite&amp;gt;). Below are some examples of their functions:&lt;br /&gt;
&lt;br /&gt;
===== PTPN6/SHP1 =====&lt;br /&gt;
PTPN6/SHP-1 dephosphorylates and inhibites Transient receptor potential vanilloid 1 (TRPV1) receptors in rat dorsal root ganglions (DRGs) &amp;lt;cite&amp;gt;Xiao15&amp;lt;/cite&amp;gt;. [http://en.wikipedia.org/wiki/TRPV1 TRPV1] is a nonselective cation channel that provides sensation of scalding heat and pain (nociception).&lt;br /&gt;
&lt;br /&gt;
The bacterial pathogen Bordetella pertussis can hijack PTPN6 (SHP-1) by the adenylate cyclase toxin-hemolysin (CyaA). CyaA penetrates complement receptor 3-expressing phagocytes and catalyzes uncontrolled conversion of cytosolic ATP to the key second messenger molecule cAMP.  CyaA/cAMP signaling induced SHP phosphatase-dependent dephosphorylation of the c-Fos subunit of the transcription factor AP-1, therefore inhibiting TLR4-triggered induction of iNOS gene expression and suppressing production of bactericidal NO in macrophage cells &amp;lt;cite&amp;gt;Cerny15&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
PTPN6 expression by NK cells is required for in vivo-mismatched bone marrow allograft rejection as well as for NK memory responses to happen &amp;lt;cite&amp;gt;Gumbleton15&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===== PTPN11/SHP2 =====&lt;br /&gt;
PTPN11 is a major player in receptor tyrosine kinase signaling to Ras, by a variety of mechanisms.&lt;br /&gt;
&lt;br /&gt;
PKA phosphorylates PTPN11/SHP-2 at Thr-73 and Ser-189 in two SH2 domains, respectively. The phosphorylation inhibits ligand-binding mediated by SH2 domains and phosphatase activity &amp;lt;cite&amp;gt;Burmeister15&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
PTPN11/SHP-2 acts as a regulator of the tyrosyl phosphorylation of FGFR4 and of its immediate target FRS2α, thus being essential for the FGF15/19-mediated activation of the FGFR4/P-ERK1/2/PKC signaling pathway as a integrator of hepatic [http://en.wikipedia.org/wiki/Bile_acid bile acid] and FGF15/FGF19 signaling &amp;lt;cite&amp;gt;Perino14&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
A PTPN11 allele encoding a catalytically impaired protein was found in a patient with a Noonan syndrome phenotype &amp;lt;cite&amp;gt;Edwards14&amp;lt;/cite&amp;gt;. But, it is unclear whether PTPN11 is a general casuative gene of Noonan syndrome.&lt;br /&gt;
&lt;br /&gt;
PTPN11 (SHP-2) can operate as a scaffold, facilitating the recruitment of kinase Syk to the CLR dectin-1 or the adaptor FcRγ, through its N-SH2 domain and a carboxy-terminal immunoreceptor tyrosine-based activation motif (ITAM) &amp;lt;cite&amp;gt;Deng15&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
PTPN11 (SHP-2) promotes liver cancer stem cell expansion by augmenting β-catenin signaling and predicts chemotherapeutic response of patients &amp;lt;cite&amp;gt;Xiang2017&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===== Drosophila Corkscrew (csw) =====&lt;br /&gt;
Drosophila has a single gene of PTPN6 subfamily, corkscrew (csw). It binds to and dephosphorylates Draper-II, an alternative splice variant of Draper &amp;lt;cite&amp;gt;Logan12&amp;lt;/cite&amp;gt;, which is orthologous to human [http://www.ncbi.nlm.nih.gov/gene/84465 MEGF11] (multiple EGF-like-domains 11).&lt;br /&gt;
&lt;br /&gt;
===References===&lt;br /&gt;
&amp;lt;biblio&amp;gt;&lt;br /&gt;
#Burmeister15 pmid=25802336&lt;br /&gt;
#Cerny15 pmid=25876760&lt;br /&gt;
#Deng15 pmid=25915733&lt;br /&gt;
#Edwards14 pmid=24891296&lt;br /&gt;
#Gumbleton15 pmid=25687756&lt;br /&gt;
#Logan12 pmid=22426252&lt;br /&gt;
#Lorenz09 pmid=19290938&lt;br /&gt;
#Neel03 pmid=12826400&lt;br /&gt;
#Perino14 pmid=25100060&lt;br /&gt;
#Poole05 pmid=16084691&lt;br /&gt;
#Xiao15 pmid=25790452&lt;br /&gt;
&amp;lt;/biblio&amp;gt;&lt;/div&gt;</summary>
		<author><name>Mark</name></author>	</entry>

	<entry>
		<id>http://www.phosphatome.net/wiki/index.php/Phosphatase_Subfamily_PTPRB</id>
		<title>Phosphatase Subfamily PTPRB</title>
		<link rel="alternate" type="text/html" href="http://www.phosphatome.net/wiki/index.php/Phosphatase_Subfamily_PTPRB"/>
				<updated>2017-01-06T14:13:58Z</updated>
		
		<summary type="html">&lt;p&gt;Mark: /* References */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;__NOTOC__&lt;br /&gt;
[[Phosphatase classification|Phosphatase Classification]]: [[Phosphatase_Fold_CC1|Fold CC1]]: [[Phosphatase_Superfamily_CC1|Superfamily CC1]]: [[Phosphatase_Family_PTP|Family PTP]]: [[Phosphatase_Subfamily_PTPRB|Subfamily PTPRB]]&lt;br /&gt;
&lt;br /&gt;
PTPRB (aka R3) is a metazoan-specific subfamily of receptor PTPs, with diverse functions.&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
PTPRB is found across metazoa, often with multiple members per species. Human members are PTPRB, PTPRH, PTPRJ, PTPRO, and PTPRQ, while C. elegans has a single gene, dep-1 and Drosophila has two: PTP4E and PTP10D.&lt;br /&gt;
&lt;br /&gt;
===Domain Structure===&lt;br /&gt;
The canonical domain structure is multiple fibronectin type III (Fn3) domains in the extracellular region and a single cytoplasmic phosphatase domain. Human PTPRQ also encodes a cytoplasmic isoform lacking the extracellular region, due to alternative promoter usage &amp;lt;cite&amp;gt;Seifert03&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Functions===&lt;br /&gt;
PTPRB from multiple species antagonizes EGFR signaling, in Drosophila tracheal development &amp;lt;cite&amp;gt;Jeon&amp;lt;/cite&amp;gt;, in C. elegans vulval development &amp;lt;cite&amp;gt;Berset05&amp;lt;/cite&amp;gt;, and PTPRJ in mammalian cell assays &amp;lt;cite&amp;gt;Tarcic09&amp;lt;/cite&amp;gt;, and multiple members dephosphorylate the insulin receptor &amp;lt;cite&amp;gt;Shintani15&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
Human PTPRB genes have varied functions, and are selectively expressed in different cell types and/or tissues and have different substrates or binding partners. They function in various tissues, such as nervous system and immune system. They are also putative tumor suppressors. They share common features, including localization at cell-cell contact sites, and involved in cell proliferation and transformation. &lt;br /&gt;
&lt;br /&gt;
====== PTPRB (VE-PTP) ======&lt;br /&gt;
PTPRB, a.k.a. vascular endothelial protein tyrosine phosphatase (VE-PTP), is expressed specifically in endothelial cells and regulates the spreading and migration of endothelial cells during angiogenesis &amp;lt;cite&amp;gt;Mori10&amp;lt;/cite&amp;gt;. &lt;br /&gt;
PTPRB binds to vascular E-cadherin (VE-cadherin) through an extracellular domain and reduces the tyrosine phosphorylation of VE-cadherin. But, the reduction of tyrosine phosphorylation seems independently of its enzymatic activity, since catalytically inactive mutant form of PTPRB had the same effect on VE-cadherin phosphorylation &amp;lt;cite&amp;gt;Nawroth02&amp;lt;/cite&amp;gt;.&lt;br /&gt;
PTPRB associates with endothelial cell (EC)-selective receptor tyrosine kinase Tie2, which maintains vascular integrity &amp;lt;cite&amp;gt;Fachinger99, Winderlich09, Yacyshyn09, Shen14&amp;lt;/cite&amp;gt;.&lt;br /&gt;
PTPRB regulates vascular endothelial growth factor receptor 2 activity thereby modulating the VEGF-response during angiogenesis &amp;lt;cite&amp;gt;Mellberg09&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
PTPRB is intrinsically active and its inactivation is dependent on its ligand pleiotrophin (PTN) which is a platelet-derived growth factor-inducible, 18-kDa heparin-binding cytokine that signals diverse phenotypes in normal and deregulated cellular growth and differentiation &amp;lt;cite&amp;gt;Meng00&amp;lt;/cite&amp;gt;. PTPRB is glycosylated protein (phosphacan).&lt;br /&gt;
&lt;br /&gt;
PTPRB mutations are observed in cancers. Its mutations are recurrent in [http://en.wikipedia.org/wiki/Angiosarcoma angiosarcoma] &amp;lt;cite&amp;gt;Behjati14&amp;lt;/cite&amp;gt;. PTPRB mediates glial tumor cell adhesion by binding to [http://en.wikipedia.org/wiki/Tenascin_C#Role_in_cancer tenascin C] &amp;lt;cite&amp;gt;Adamsky01&amp;lt;/cite&amp;gt;. &lt;br /&gt;
&lt;br /&gt;
PTPRB interacts with neuronal receptors and promotes neurite outgrowth &amp;lt;cite&amp;gt;Garwood03&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
====== PTPRH (SAP-1) ======&lt;br /&gt;
PTPRH was mainly expressed in brain and liver and at a lower level in heart and stomach as a 4.2-kilobase mRNA, but it was not detected in pancreas or colon. In contrast, among cancer cell lines tested, PTPRH was highly expressed in pancreatic and colorectal cancer cells &amp;lt;cite&amp;gt;Matozaki94&amp;lt;/cite&amp;gt;. It is downregulated in advanced human hepatocellular carcinoma &amp;lt;cite&amp;gt;Nagano03&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
PTPRH induces apoptotic cell death and inhibit cell growth and motility. PTPRH inhibits integrin signaling by mediating the dephosphorylation of focal adhesion-associated proteins. It dephosphorylates [http://en.wikipedia.org/wiki/BCAR1 p130cas/BCAR1], a major focal adhesion (FA)-associated component of the integrin signaling pathway &amp;lt;cite&amp;gt;Noguchi01&amp;lt;/cite&amp;gt;. Forced expression of recombinant PTPRH results in the dephosphorylation of several additional FA-associated proteins, including focal adhesion kinase (FAK) and Dok-1 as well as in impairment of reorganization of the actin-based cytoskeleton &amp;lt;cite&amp;gt;Noguchi01&amp;lt;/cite&amp;gt;. Overexpression of PTPRH also results in the inactivation of both Akt (protein kinase B) and integrin-linked kinase (ILK) &amp;lt;cite&amp;gt;Takada02&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
Besides, PTPRH binds to and dephosphorylates kinase Lck therefore regulating T cell function &amp;lt;cite&amp;gt;Ito03&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
====== PTPRJ (CD148/DEP1/RPTP eta) ======&lt;br /&gt;
PTPRJ is a tumor suppressor implicated in a range of cancers &amp;lt;cite&amp;gt;Massa04, Trapasso04, Iuliano04, Balavenkatraman06, Venkatachalam10, Omerovic10, AyaBonilla13, Petermann11, Arora11&amp;lt;/cite&amp;gt;. However, PTPRJ also mediates the invasive cell program implicating Src activation and the promotion of breast cancer progression &amp;lt;cite&amp;gt;Spring15&amp;lt;/cite&amp;gt;. &lt;br /&gt;
&lt;br /&gt;
It plays a prominent role in negative regulation of growth factor signals, suppressing cell proliferation and transformation &amp;lt;cite&amp;gt;Smart12&amp;lt;/cite&amp;gt;. Thus, PTPRJ is involved in many cellular processes and human diseases. In particular, it is involved in the regulation of human T cell activation &amp;lt;cite&amp;gt;Tangye98&amp;lt;/cite&amp;gt;. PTPRJ/DEP1 is a putative negative regulator of insulin signaling &amp;lt;cite&amp;gt;Kruger15&amp;lt;/cite&amp;gt;. PTPRJ is expressed in several cell types &amp;lt;cite&amp;gt;Autschbach99, Takahashi12&amp;lt;/cite&amp;gt;. &lt;br /&gt;
&lt;br /&gt;
PTPRJ has ligands:&lt;br /&gt;
&lt;br /&gt;
* [http://en.wikipedia.org/wiki/Thrombospondin_1 Thrombospondin-1] &amp;lt;cite&amp;gt;Takahashi12&amp;lt;/cite&amp;gt;, an adhesive glycoprotein that mediates cell-to-cell and cell-to-matrix interactions. It is a natural inhibitor of neovascularization and tumorigenesis in healthy tissue.&lt;br /&gt;
* [http://en.wikipedia.org/wiki/SDC2 Syndecan-2] &amp;lt;cite&amp;gt;Whiteford11&amp;lt;/cite&amp;gt;, a heparan sulfate proteoglycan participates in cell proliferation, cell migration and cell-matrix interactions via its receptor for extracellular matrix proteins.&lt;br /&gt;
&lt;br /&gt;
PTPRJ dephosphorylates  growth factor receptors as well as other substrates:&lt;br /&gt;
&lt;br /&gt;
* [http://en.wikipedia.org/wiki/Epidermal_growth_factor_receptor EGFR], a subfamily of receptor tyrosine kinases (RTKs). PTPRJ dephosphorylates and thereby stabilizes EGFR by hampering its ability to associate with the CBL-GRB2 ubiquitin ligase complex. Interestingly, the interactions of DEP-1 and EGFR are followed by physical segregation: whereas EGFR undergoes endocytosis, DEP-1 remains confined to the cell surface &amp;lt;cite&amp;gt;Tarcic09&amp;lt;/cite&amp;gt;.&lt;br /&gt;
* [http://en.wikipedia.org/wiki/VEGF_receptors VEGFR2], a member of VEGFR subfamily (not EGFR subfamily), receptor tyrosine kinase family &amp;lt;cite&amp;gt;Chabot09&amp;lt;/cite&amp;gt;.&lt;br /&gt;
* Insulin receptor (IR). PTPRJ preferentially dephosphorylated a particular phosphorylation site of the IR: Y960 in the juxtamembrane region and Y1146 in the activation loop &amp;lt;cite&amp;gt; Shintani15&amp;lt;/cite&amp;gt;. &lt;br /&gt;
* [http://en.wikipedia.org/wiki/RET_proto-oncogene RET proto-oncogene], a receptor tyrosine kinase (RTK), gain of which causes various types of cancers &amp;lt;cite&amp;gt;Iervolino06&amp;lt;/cite&amp;gt;.&lt;br /&gt;
* [http://en.wikipedia.org/wiki/CD135 CD135/FLT3], a receptor tyrosine kinase (RTK) plays an important role in hematopoietic differentiation, and constitutively active FLT3 mutant proteins contribute to the development of acute myeloid leukemia. PTPRJ negatively regulates FLT3 phosphorylation and signaling &amp;lt;cite&amp;gt;Arora11, Bohmer13&amp;lt;/cite&amp;gt;. The activity can be turned off through oxidation of the DEP-1 catalytic cysteine &amp;lt;cite&amp;gt;Godfrey12&amp;lt;/cite&amp;gt;.&lt;br /&gt;
* [http://en.wikipedia.org/wiki/Platelet-derived_growth_factor_receptor platelet-derived growth factor beta], a receptor tyrosine kinase (RTK) &amp;lt;cite&amp;gt;Kovalenko00, Persson02&amp;lt;/cite&amp;gt;.&lt;br /&gt;
* [http://en.wikipedia.org/wiki/C-Met Met proto-oncogene (aka hepatocyte growth factor receptor (HGFR))], a receptor tyrosine kinase (RTK). PTPRJ preferentially dephosphorylated a Gab1 binding site (Tyr(1349)) and a COOH-terminal tyrosine implicated in morphogenesis (Tyr(1365)), whereas tyrosine residues in the activation loop of Met (Tyr(1230), Tyr(1234), and Tyr(1235)) were not preferred targets of the PTP &amp;lt;cite&amp;gt;Palka03&amp;lt;/cite&amp;gt;. &lt;br /&gt;
* [http://en.wikipedia.org/wiki/Tyrosine-protein_kinase_CSK c-Src], a tyrosine kinase (TK). PTPRJ dephosphorylates c-Src inhibitory tyrosine phosphorylation site (Tyr 529) &amp;lt;cite&amp;gt;Pera05&amp;lt;/cite&amp;gt; PTPN22 can reduce the level of phosphorylation of c-Src as well, but it is unclear whether they work on the same residue &amp;lt;cite&amp;gt;Fiorillo04, Stepanek11&amp;lt;/cite&amp;gt;.&lt;br /&gt;
* [http://en.wikipedia.org/wiki/MAPK3 ERK1] and [http://en.wikipedia.org/wiki/MAPK1 ERK2]. Eextracellular signal-regulated kinase (ERKs) belong to Mitogen-Activated Protein Kinase (MAPK) family. They act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. PTPRJ specifically dephosphorylated tyrosine 204 of ERK1/2.  &amp;lt;cite&amp;gt;Sacco09&amp;lt;/cite&amp;gt;.&lt;br /&gt;
* [http://en.wikipedia.org/wiki/Phosphoinositide_3-kinase p85 regulatory subunit of phosphoinositide 3-kinase (PI3K)] &amp;lt;cite&amp;gt;Tsuboi08&amp;lt;/cite&amp;gt;&lt;br /&gt;
* [http://en.wikipedia.org/wiki/Occludin Occludin], an integral plasma-membrane protein which is the main component of the tight junctions &amp;lt;cite&amp;gt;Sallee09&amp;lt;/cite&amp;gt;.&lt;br /&gt;
* [http://en.wikipedia.org/wiki/Tight_junction_protein_1 ZO1], a protein located on a cytoplasmic membrane surface of intercellular tight junctions &amp;lt;cite&amp;gt;Salle09&amp;lt;/cite&amp;gt;.&lt;br /&gt;
* [http://en.wikipedia.org/wiki/CTNND1 CTNND1/p120 catenin], a member of the Armadillo protein family, which function in adhesion between cells and signal transduction &amp;lt;cite&amp;gt;Holsinger02&amp;lt;/cite&amp;gt;.&lt;br /&gt;
* PTPRJ can reduce phospholipase Cgamma1 ([http://en.wikipedia.org/wiki/PLCG1 PLCG1]) and LAT phosphorylation and inhibit T-cell receptor signal transduction &amp;lt;cite&amp;gt;Baker01&amp;lt;/cite&amp;gt;.. But, it is unclear whether they are PTPRJ's physiological substrates. In fact, PTPRC/CD45 also reduces PLCG1 phosphorylation.&lt;br /&gt;
&lt;br /&gt;
PTPRJ has functions independent of its phosphatase activity. &lt;br /&gt;
&lt;br /&gt;
PTPRJ has a putative shorter spliced variant (denoted as sPTPRJ), coding for a 539 aa protein corresponding to the extracellular N-terminus. It is a soluble protein secreted into the supernatant of both endothelial and tumor cells. Like PTPRJ, sPTPRJ undergoes post-translational modifications such as glycosylation, as assessed by sPTPRJ immunoprecipitation &amp;lt;cite&amp;gt;Bilotta2016&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
====== PTPRO (GLEPP1/PTP phi) ======&lt;br /&gt;
PTPRO is a tumor suppressor and frequently methylated in various types of cancers &amp;lt;cite&amp;gt;Motiwala04, Motiwala07, Ramaswamy09, You12, Huang13, Hsu13&amp;lt;/cite&amp;gt;. PTPRO can be reliably detected in peripheral blood samples, and is a potential biomarker in cancer diagnosis and prognosis.&lt;br /&gt;
PTPRO has multiple isoforms. Monoclonal and polyclonal antibodies raised against a human PTPRO fusion protein recognized a protein with distribution restricted to the glomerulus in human kidney &amp;lt;cite&amp;gt;Wiggins95&amp;lt;/cite&amp;gt;. &lt;br /&gt;
Interestingly, dimerization of PTPRO inhibit its activity, as dimerization of a related RPTP, CD148/PTPRJ, increases activity &amp;lt;cite&amp;gt;Hower09&amp;lt;/cite&amp;gt;. &lt;br /&gt;
&lt;br /&gt;
PTPRO dephosphorylates kinases SYK at BCR-triggered tyrosyl phosphorylation &amp;lt;cite&amp;gt;Chen06&amp;lt;/cite&amp;gt;, ZAP70 (SYK family kinase) &amp;lt;cite&amp;gt;Motiwala10&amp;lt;/cite&amp;gt;, Lyn (Src family kinase)&amp;lt;cite&amp;gt;Motiwala10&amp;lt;/cite&amp;gt;, TrkC (Trk family kinase) &amp;lt;cite&amp;gt;Hower09&amp;lt;/cite&amp;gt;, and ErbB2 (EGFR family kinase) &amp;lt;cite&amp;gt;Yu12&amp;lt;/cite&amp;gt;. &lt;br /&gt;
PTPRO also dephosphorylates [http://en.wikipedia.org/wiki/Paxillin paxillin] &amp;lt;cite&amp;gt;Pixley95, Pixley11&amp;lt;/cite&amp;gt; and VCP/p97 &amp;lt;cite&amp;gt;Hsu13&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
PTPRO interacts with Toll-like receptor 4 (TLR4) a gene plays diverse roles in HCC tumorigenesis and progression &amp;lt;cite&amp;gt;Xu14&amp;lt;/cite&amp;gt;. &lt;br /&gt;
PTPRO dephosphorylates and inactivates the oncogenic fusion protein BCR/ABL &amp;lt;cite&amp;gt;Motiwala09&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
In human and mouse models of hepatic ischemia reperfusion (IR) injury, PTPRO activates NF-κB in a positive feedback manner. PTPRO level was decreased in the early phase but reversed in the late phase. In vitro studies demonstrated that NF-κB up-regulated PTPRO transcription. PTPRO deficiency in mouse resulted in reduction of NF-κB activation in both hepatocytes and macrophages and was correlated to c-Src phosphorylation; PTPRO in hepatocytes alleviated, but PTPROt in macrophages exacerbated IR injury &amp;lt;cite&amp;gt;Hou14&amp;lt;/cite&amp;gt;. &lt;br /&gt;
&lt;br /&gt;
PTPRO regulates the growth of specific B-cell subpopulations by promoting G0/G1 arrest &amp;lt;cite&amp;gt;Aguiar99&amp;lt;/cite&amp;gt;.&lt;br /&gt;
PTPRO mutations can cause autosomal-recessive nephrotic syndrome &amp;lt;cite&amp;gt;Ozaltin11&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
====== PTPRQ ======&lt;br /&gt;
PTPRQ is a phosphatidylinositol phosphatase rather than protein tyrosine phosphatase as all the other members in [[Phosphatase_Family_PTP|PTP family]]. PTPRQ has low phosphatase activity against tyrosine-phosphorylated peptide and protein substrates but can dephosphorylate a broad range of phosphatidylinositol phosphates, including phosphatidylinositol 3,4,5-trisphosphate and most phosphatidylinositol monophosphates and diphosphates, with a preference for PI(3,4,5)P3 &amp;lt;cite&amp;gt;Yu13&amp;lt;/cite&amp;gt;. This shift in activity correlates with a change of the WPD tyrosine-specific motif to WPE. Overexpression of PTPRQ in cultured cells inhibits proliferation and induces apoptosis. An E2171D mutation that retains or increases tyrosine phosphatase activity but eliminates phosphatidylinositol phosphatase activity, eliminates the inhibitory effects on proliferation and apoptosis. &lt;br /&gt;
&lt;br /&gt;
Mutations in PTPRQ can cause hearing impairment (DFNB84), including one missense mutation in an FN3 domain and a nonsense mutation early in the extracellular region  &amp;lt;cite&amp;gt;Shahin10, Schraders10&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
PTPRQ has also been shown to involved in differentiation during adipogenesis of human mesenchymal stem cells &amp;lt;cite&amp;gt;Jung09&amp;lt;/cite&amp;gt; and regulation the adhesion and migration of mesangial cells in response to injury &amp;lt;cite&amp;gt;Wright98&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
PTPRQ is seen in all vertebrates, and a likely ortholog (XP_002123247.3) also exists in Ciona intestinalis.&lt;br /&gt;
&lt;br /&gt;
===References===&lt;br /&gt;
&amp;lt;biblio&amp;gt;&lt;br /&gt;
#Adamsky01 pmid=11313993&lt;br /&gt;
#Aguiar99 pmid=10498613&lt;br /&gt;
#Arora11 pmid=21262971&lt;br /&gt;
#Autschbach99 pmid=10599888&lt;br /&gt;
#AyaBonilla13 pmid=23341091&lt;br /&gt;
#Baker01 pmid=11259588&lt;br /&gt;
#Balavenkatraman06 pmid=16682945&lt;br /&gt;
#Behjati14 pmid=24633157&lt;br /&gt;
#Berset05 pmid=15901674&lt;br /&gt;
#Bilotta2016 pmid=28052032&lt;br /&gt;
#Bohmer13 pmid=23650535&lt;br /&gt;
#Brunner11 pmid=21304107&lt;br /&gt;
#Chabot09 pmid=18936167&lt;br /&gt;
#Chen06 pmid=16888096&lt;br /&gt;
#Fachinger99 pmid=10557082&lt;br /&gt;
#Fiorillo04 pmid=20538612&lt;br /&gt;
#Garwood03 pmid=12700241&lt;br /&gt;
#Godfrey12 pmid=22438257&lt;br /&gt;
#Holsinger02 pmid=12370829&lt;br /&gt;
#Hower09 pmid=19573017&lt;br /&gt;
#Huang13 pmid=24090193&lt;br /&gt;
#Hsu13 pmid=23533167&lt;br /&gt;
#Iervolino06 pmid=16778204&lt;br /&gt;
#Ito03 pmid=12837766&lt;br /&gt;
#Iuliano04 pmid=15378013&lt;br /&gt;
#Jeon pmid=19675131&lt;br /&gt;
#Jung09 pmid=19351528&lt;br /&gt;
#Kovalenko00 pmid=10821867&lt;br /&gt;
#Kruger15 pmid=25830095&lt;br /&gt;
#Wright98 pmid=9727007&lt;br /&gt;
#Massa04 pmid=15123617&lt;br /&gt;
#Motiwala04 pmid=15356345&lt;br /&gt;
#Motiwala07 pmid=17545520&lt;br /&gt;
#Motiwala09 pmid=18997174&lt;br /&gt;
#Motiwala10 pmid=20564182&lt;br /&gt;
#Matozaki94 pmid=8294459&lt;br /&gt;
#Mellberg09 pmid=19136612&lt;br /&gt;
#Meng00 pmid=10706604&lt;br /&gt;
#Mori10 pmid=20301196&lt;br /&gt;
#Nagano03 pmid=12879010&lt;br /&gt;
#Noguchi01 pmid=11278335&lt;br /&gt;
#Nawroth02 pmid=12234928&lt;br /&gt;
#Omerovic10 pmid=19922411&lt;br /&gt;
#Ozaltin11 pmid=21722858&lt;br /&gt;
#Palka03 pmid=12475979&lt;br /&gt;
#Petermann11 pmid=21091576&lt;br /&gt;
#Pera05 pmid=15735685&lt;br /&gt;
#Persson02 pmid=12062403&lt;br /&gt;
#Pixley95 pmid=7592997&lt;br /&gt;
#Pixley01 pmid=11238916&lt;br /&gt;
#Ramaswamy09 pmid=19095770&lt;br /&gt;
#Sacco09 pmid=19494114&lt;br /&gt;
#Sallee09 pmid=19122201&lt;br /&gt;
#Schraders10 pmid=20346435&lt;br /&gt;
#Seifert03 pmid=12837292&lt;br /&gt;
#Shen14 pmid=25180601&lt;br /&gt;
#Shahin10 pmid=20472657&lt;br /&gt;
#Shintani15 pmid=26063811&lt;br /&gt;
#Smart12 pmid=22815804&lt;br /&gt;
#Spring15 pmid=25772245&lt;br /&gt;
#Stepanek11 pmid=21543337&lt;br /&gt;
#Takada02 pmid=12101188&lt;br /&gt;
#Takahashi12 pmid=22308318&lt;br /&gt;
#Tangye98 pmid=9759839&lt;br /&gt;
#Tarcic09 pmid=19836242&lt;br /&gt;
#Trapasso04 pmid=15231692&lt;br /&gt;
#Tsuboi08 pmid=18348712&lt;br /&gt;
#Venkatachalam10 pmid=21036128&lt;br /&gt;
#Whiteford11 pmid=21813734&lt;br /&gt;
#Wiggins95 pmid=7665166&lt;br /&gt;
#Winderlich09 pmid=19451274&lt;br /&gt;
#Xu14 pmid=25034527&lt;br /&gt;
#Yacyshyn09 pmid=19116766&lt;br /&gt;
#You12 pmid=22099875&lt;br /&gt;
#Yu12 pmid=22851698&lt;br /&gt;
#Yu13 pmid=23897475&lt;br /&gt;
&amp;lt;/biblio&amp;gt;&lt;/div&gt;</summary>
		<author><name>Mark</name></author>	</entry>

	<entry>
		<id>http://www.phosphatome.net/wiki/index.php/Phosphatase_Subfamily_PTPRB</id>
		<title>Phosphatase Subfamily PTPRB</title>
		<link rel="alternate" type="text/html" href="http://www.phosphatome.net/wiki/index.php/Phosphatase_Subfamily_PTPRB"/>
				<updated>2017-01-06T14:13:06Z</updated>
		
		<summary type="html">&lt;p&gt;Mark: /* PTPRJ (CD148/DEP1/RPTP eta) */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;__NOTOC__&lt;br /&gt;
[[Phosphatase classification|Phosphatase Classification]]: [[Phosphatase_Fold_CC1|Fold CC1]]: [[Phosphatase_Superfamily_CC1|Superfamily CC1]]: [[Phosphatase_Family_PTP|Family PTP]]: [[Phosphatase_Subfamily_PTPRB|Subfamily PTPRB]]&lt;br /&gt;
&lt;br /&gt;
PTPRB (aka R3) is a metazoan-specific subfamily of receptor PTPs, with diverse functions.&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
PTPRB is found across metazoa, often with multiple members per species. Human members are PTPRB, PTPRH, PTPRJ, PTPRO, and PTPRQ, while C. elegans has a single gene, dep-1 and Drosophila has two: PTP4E and PTP10D.&lt;br /&gt;
&lt;br /&gt;
===Domain Structure===&lt;br /&gt;
The canonical domain structure is multiple fibronectin type III (Fn3) domains in the extracellular region and a single cytoplasmic phosphatase domain. Human PTPRQ also encodes a cytoplasmic isoform lacking the extracellular region, due to alternative promoter usage &amp;lt;cite&amp;gt;Seifert03&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Functions===&lt;br /&gt;
PTPRB from multiple species antagonizes EGFR signaling, in Drosophila tracheal development &amp;lt;cite&amp;gt;Jeon&amp;lt;/cite&amp;gt;, in C. elegans vulval development &amp;lt;cite&amp;gt;Berset05&amp;lt;/cite&amp;gt;, and PTPRJ in mammalian cell assays &amp;lt;cite&amp;gt;Tarcic09&amp;lt;/cite&amp;gt;, and multiple members dephosphorylate the insulin receptor &amp;lt;cite&amp;gt;Shintani15&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
Human PTPRB genes have varied functions, and are selectively expressed in different cell types and/or tissues and have different substrates or binding partners. They function in various tissues, such as nervous system and immune system. They are also putative tumor suppressors. They share common features, including localization at cell-cell contact sites, and involved in cell proliferation and transformation. &lt;br /&gt;
&lt;br /&gt;
====== PTPRB (VE-PTP) ======&lt;br /&gt;
PTPRB, a.k.a. vascular endothelial protein tyrosine phosphatase (VE-PTP), is expressed specifically in endothelial cells and regulates the spreading and migration of endothelial cells during angiogenesis &amp;lt;cite&amp;gt;Mori10&amp;lt;/cite&amp;gt;. &lt;br /&gt;
PTPRB binds to vascular E-cadherin (VE-cadherin) through an extracellular domain and reduces the tyrosine phosphorylation of VE-cadherin. But, the reduction of tyrosine phosphorylation seems independently of its enzymatic activity, since catalytically inactive mutant form of PTPRB had the same effect on VE-cadherin phosphorylation &amp;lt;cite&amp;gt;Nawroth02&amp;lt;/cite&amp;gt;.&lt;br /&gt;
PTPRB associates with endothelial cell (EC)-selective receptor tyrosine kinase Tie2, which maintains vascular integrity &amp;lt;cite&amp;gt;Fachinger99, Winderlich09, Yacyshyn09, Shen14&amp;lt;/cite&amp;gt;.&lt;br /&gt;
PTPRB regulates vascular endothelial growth factor receptor 2 activity thereby modulating the VEGF-response during angiogenesis &amp;lt;cite&amp;gt;Mellberg09&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
PTPRB is intrinsically active and its inactivation is dependent on its ligand pleiotrophin (PTN) which is a platelet-derived growth factor-inducible, 18-kDa heparin-binding cytokine that signals diverse phenotypes in normal and deregulated cellular growth and differentiation &amp;lt;cite&amp;gt;Meng00&amp;lt;/cite&amp;gt;. PTPRB is glycosylated protein (phosphacan).&lt;br /&gt;
&lt;br /&gt;
PTPRB mutations are observed in cancers. Its mutations are recurrent in [http://en.wikipedia.org/wiki/Angiosarcoma angiosarcoma] &amp;lt;cite&amp;gt;Behjati14&amp;lt;/cite&amp;gt;. PTPRB mediates glial tumor cell adhesion by binding to [http://en.wikipedia.org/wiki/Tenascin_C#Role_in_cancer tenascin C] &amp;lt;cite&amp;gt;Adamsky01&amp;lt;/cite&amp;gt;. &lt;br /&gt;
&lt;br /&gt;
PTPRB interacts with neuronal receptors and promotes neurite outgrowth &amp;lt;cite&amp;gt;Garwood03&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
====== PTPRH (SAP-1) ======&lt;br /&gt;
PTPRH was mainly expressed in brain and liver and at a lower level in heart and stomach as a 4.2-kilobase mRNA, but it was not detected in pancreas or colon. In contrast, among cancer cell lines tested, PTPRH was highly expressed in pancreatic and colorectal cancer cells &amp;lt;cite&amp;gt;Matozaki94&amp;lt;/cite&amp;gt;. It is downregulated in advanced human hepatocellular carcinoma &amp;lt;cite&amp;gt;Nagano03&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
PTPRH induces apoptotic cell death and inhibit cell growth and motility. PTPRH inhibits integrin signaling by mediating the dephosphorylation of focal adhesion-associated proteins. It dephosphorylates [http://en.wikipedia.org/wiki/BCAR1 p130cas/BCAR1], a major focal adhesion (FA)-associated component of the integrin signaling pathway &amp;lt;cite&amp;gt;Noguchi01&amp;lt;/cite&amp;gt;. Forced expression of recombinant PTPRH results in the dephosphorylation of several additional FA-associated proteins, including focal adhesion kinase (FAK) and Dok-1 as well as in impairment of reorganization of the actin-based cytoskeleton &amp;lt;cite&amp;gt;Noguchi01&amp;lt;/cite&amp;gt;. Overexpression of PTPRH also results in the inactivation of both Akt (protein kinase B) and integrin-linked kinase (ILK) &amp;lt;cite&amp;gt;Takada02&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
Besides, PTPRH binds to and dephosphorylates kinase Lck therefore regulating T cell function &amp;lt;cite&amp;gt;Ito03&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
====== PTPRJ (CD148/DEP1/RPTP eta) ======&lt;br /&gt;
PTPRJ is a tumor suppressor implicated in a range of cancers &amp;lt;cite&amp;gt;Massa04, Trapasso04, Iuliano04, Balavenkatraman06, Venkatachalam10, Omerovic10, AyaBonilla13, Petermann11, Arora11&amp;lt;/cite&amp;gt;. However, PTPRJ also mediates the invasive cell program implicating Src activation and the promotion of breast cancer progression &amp;lt;cite&amp;gt;Spring15&amp;lt;/cite&amp;gt;. &lt;br /&gt;
&lt;br /&gt;
It plays a prominent role in negative regulation of growth factor signals, suppressing cell proliferation and transformation &amp;lt;cite&amp;gt;Smart12&amp;lt;/cite&amp;gt;. Thus, PTPRJ is involved in many cellular processes and human diseases. In particular, it is involved in the regulation of human T cell activation &amp;lt;cite&amp;gt;Tangye98&amp;lt;/cite&amp;gt;. PTPRJ/DEP1 is a putative negative regulator of insulin signaling &amp;lt;cite&amp;gt;Kruger15&amp;lt;/cite&amp;gt;. PTPRJ is expressed in several cell types &amp;lt;cite&amp;gt;Autschbach99, Takahashi12&amp;lt;/cite&amp;gt;. &lt;br /&gt;
&lt;br /&gt;
PTPRJ has ligands:&lt;br /&gt;
&lt;br /&gt;
* [http://en.wikipedia.org/wiki/Thrombospondin_1 Thrombospondin-1] &amp;lt;cite&amp;gt;Takahashi12&amp;lt;/cite&amp;gt;, an adhesive glycoprotein that mediates cell-to-cell and cell-to-matrix interactions. It is a natural inhibitor of neovascularization and tumorigenesis in healthy tissue.&lt;br /&gt;
* [http://en.wikipedia.org/wiki/SDC2 Syndecan-2] &amp;lt;cite&amp;gt;Whiteford11&amp;lt;/cite&amp;gt;, a heparan sulfate proteoglycan participates in cell proliferation, cell migration and cell-matrix interactions via its receptor for extracellular matrix proteins.&lt;br /&gt;
&lt;br /&gt;
PTPRJ dephosphorylates  growth factor receptors as well as other substrates:&lt;br /&gt;
&lt;br /&gt;
* [http://en.wikipedia.org/wiki/Epidermal_growth_factor_receptor EGFR], a subfamily of receptor tyrosine kinases (RTKs). PTPRJ dephosphorylates and thereby stabilizes EGFR by hampering its ability to associate with the CBL-GRB2 ubiquitin ligase complex. Interestingly, the interactions of DEP-1 and EGFR are followed by physical segregation: whereas EGFR undergoes endocytosis, DEP-1 remains confined to the cell surface &amp;lt;cite&amp;gt;Tarcic09&amp;lt;/cite&amp;gt;.&lt;br /&gt;
* [http://en.wikipedia.org/wiki/VEGF_receptors VEGFR2], a member of VEGFR subfamily (not EGFR subfamily), receptor tyrosine kinase family &amp;lt;cite&amp;gt;Chabot09&amp;lt;/cite&amp;gt;.&lt;br /&gt;
* Insulin receptor (IR). PTPRJ preferentially dephosphorylated a particular phosphorylation site of the IR: Y960 in the juxtamembrane region and Y1146 in the activation loop &amp;lt;cite&amp;gt; Shintani15&amp;lt;/cite&amp;gt;. &lt;br /&gt;
* [http://en.wikipedia.org/wiki/RET_proto-oncogene RET proto-oncogene], a receptor tyrosine kinase (RTK), gain of which causes various types of cancers &amp;lt;cite&amp;gt;Iervolino06&amp;lt;/cite&amp;gt;.&lt;br /&gt;
* [http://en.wikipedia.org/wiki/CD135 CD135/FLT3], a receptor tyrosine kinase (RTK) plays an important role in hematopoietic differentiation, and constitutively active FLT3 mutant proteins contribute to the development of acute myeloid leukemia. PTPRJ negatively regulates FLT3 phosphorylation and signaling &amp;lt;cite&amp;gt;Arora11, Bohmer13&amp;lt;/cite&amp;gt;. The activity can be turned off through oxidation of the DEP-1 catalytic cysteine &amp;lt;cite&amp;gt;Godfrey12&amp;lt;/cite&amp;gt;.&lt;br /&gt;
* [http://en.wikipedia.org/wiki/Platelet-derived_growth_factor_receptor platelet-derived growth factor beta], a receptor tyrosine kinase (RTK) &amp;lt;cite&amp;gt;Kovalenko00, Persson02&amp;lt;/cite&amp;gt;.&lt;br /&gt;
* [http://en.wikipedia.org/wiki/C-Met Met proto-oncogene (aka hepatocyte growth factor receptor (HGFR))], a receptor tyrosine kinase (RTK). PTPRJ preferentially dephosphorylated a Gab1 binding site (Tyr(1349)) and a COOH-terminal tyrosine implicated in morphogenesis (Tyr(1365)), whereas tyrosine residues in the activation loop of Met (Tyr(1230), Tyr(1234), and Tyr(1235)) were not preferred targets of the PTP &amp;lt;cite&amp;gt;Palka03&amp;lt;/cite&amp;gt;. &lt;br /&gt;
* [http://en.wikipedia.org/wiki/Tyrosine-protein_kinase_CSK c-Src], a tyrosine kinase (TK). PTPRJ dephosphorylates c-Src inhibitory tyrosine phosphorylation site (Tyr 529) &amp;lt;cite&amp;gt;Pera05&amp;lt;/cite&amp;gt; PTPN22 can reduce the level of phosphorylation of c-Src as well, but it is unclear whether they work on the same residue &amp;lt;cite&amp;gt;Fiorillo04, Stepanek11&amp;lt;/cite&amp;gt;.&lt;br /&gt;
* [http://en.wikipedia.org/wiki/MAPK3 ERK1] and [http://en.wikipedia.org/wiki/MAPK1 ERK2]. Eextracellular signal-regulated kinase (ERKs) belong to Mitogen-Activated Protein Kinase (MAPK) family. They act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. PTPRJ specifically dephosphorylated tyrosine 204 of ERK1/2.  &amp;lt;cite&amp;gt;Sacco09&amp;lt;/cite&amp;gt;.&lt;br /&gt;
* [http://en.wikipedia.org/wiki/Phosphoinositide_3-kinase p85 regulatory subunit of phosphoinositide 3-kinase (PI3K)] &amp;lt;cite&amp;gt;Tsuboi08&amp;lt;/cite&amp;gt;&lt;br /&gt;
* [http://en.wikipedia.org/wiki/Occludin Occludin], an integral plasma-membrane protein which is the main component of the tight junctions &amp;lt;cite&amp;gt;Sallee09&amp;lt;/cite&amp;gt;.&lt;br /&gt;
* [http://en.wikipedia.org/wiki/Tight_junction_protein_1 ZO1], a protein located on a cytoplasmic membrane surface of intercellular tight junctions &amp;lt;cite&amp;gt;Salle09&amp;lt;/cite&amp;gt;.&lt;br /&gt;
* [http://en.wikipedia.org/wiki/CTNND1 CTNND1/p120 catenin], a member of the Armadillo protein family, which function in adhesion between cells and signal transduction &amp;lt;cite&amp;gt;Holsinger02&amp;lt;/cite&amp;gt;.&lt;br /&gt;
* PTPRJ can reduce phospholipase Cgamma1 ([http://en.wikipedia.org/wiki/PLCG1 PLCG1]) and LAT phosphorylation and inhibit T-cell receptor signal transduction &amp;lt;cite&amp;gt;Baker01&amp;lt;/cite&amp;gt;.. But, it is unclear whether they are PTPRJ's physiological substrates. In fact, PTPRC/CD45 also reduces PLCG1 phosphorylation.&lt;br /&gt;
&lt;br /&gt;
PTPRJ has functions independent of its phosphatase activity. &lt;br /&gt;
&lt;br /&gt;
PTPRJ has a putative shorter spliced variant (denoted as sPTPRJ), coding for a 539 aa protein corresponding to the extracellular N-terminus. It is a soluble protein secreted into the supernatant of both endothelial and tumor cells. Like PTPRJ, sPTPRJ undergoes post-translational modifications such as glycosylation, as assessed by sPTPRJ immunoprecipitation &amp;lt;cite&amp;gt;Bilotta2016&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
====== PTPRO (GLEPP1/PTP phi) ======&lt;br /&gt;
PTPRO is a tumor suppressor and frequently methylated in various types of cancers &amp;lt;cite&amp;gt;Motiwala04, Motiwala07, Ramaswamy09, You12, Huang13, Hsu13&amp;lt;/cite&amp;gt;. PTPRO can be reliably detected in peripheral blood samples, and is a potential biomarker in cancer diagnosis and prognosis.&lt;br /&gt;
PTPRO has multiple isoforms. Monoclonal and polyclonal antibodies raised against a human PTPRO fusion protein recognized a protein with distribution restricted to the glomerulus in human kidney &amp;lt;cite&amp;gt;Wiggins95&amp;lt;/cite&amp;gt;. &lt;br /&gt;
Interestingly, dimerization of PTPRO inhibit its activity, as dimerization of a related RPTP, CD148/PTPRJ, increases activity &amp;lt;cite&amp;gt;Hower09&amp;lt;/cite&amp;gt;. &lt;br /&gt;
&lt;br /&gt;
PTPRO dephosphorylates kinases SYK at BCR-triggered tyrosyl phosphorylation &amp;lt;cite&amp;gt;Chen06&amp;lt;/cite&amp;gt;, ZAP70 (SYK family kinase) &amp;lt;cite&amp;gt;Motiwala10&amp;lt;/cite&amp;gt;, Lyn (Src family kinase)&amp;lt;cite&amp;gt;Motiwala10&amp;lt;/cite&amp;gt;, TrkC (Trk family kinase) &amp;lt;cite&amp;gt;Hower09&amp;lt;/cite&amp;gt;, and ErbB2 (EGFR family kinase) &amp;lt;cite&amp;gt;Yu12&amp;lt;/cite&amp;gt;. &lt;br /&gt;
PTPRO also dephosphorylates [http://en.wikipedia.org/wiki/Paxillin paxillin] &amp;lt;cite&amp;gt;Pixley95, Pixley11&amp;lt;/cite&amp;gt; and VCP/p97 &amp;lt;cite&amp;gt;Hsu13&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
PTPRO interacts with Toll-like receptor 4 (TLR4) a gene plays diverse roles in HCC tumorigenesis and progression &amp;lt;cite&amp;gt;Xu14&amp;lt;/cite&amp;gt;. &lt;br /&gt;
PTPRO dephosphorylates and inactivates the oncogenic fusion protein BCR/ABL &amp;lt;cite&amp;gt;Motiwala09&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
In human and mouse models of hepatic ischemia reperfusion (IR) injury, PTPRO activates NF-κB in a positive feedback manner. PTPRO level was decreased in the early phase but reversed in the late phase. In vitro studies demonstrated that NF-κB up-regulated PTPRO transcription. PTPRO deficiency in mouse resulted in reduction of NF-κB activation in both hepatocytes and macrophages and was correlated to c-Src phosphorylation; PTPRO in hepatocytes alleviated, but PTPROt in macrophages exacerbated IR injury &amp;lt;cite&amp;gt;Hou14&amp;lt;/cite&amp;gt;. &lt;br /&gt;
&lt;br /&gt;
PTPRO regulates the growth of specific B-cell subpopulations by promoting G0/G1 arrest &amp;lt;cite&amp;gt;Aguiar99&amp;lt;/cite&amp;gt;.&lt;br /&gt;
PTPRO mutations can cause autosomal-recessive nephrotic syndrome &amp;lt;cite&amp;gt;Ozaltin11&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
====== PTPRQ ======&lt;br /&gt;
PTPRQ is a phosphatidylinositol phosphatase rather than protein tyrosine phosphatase as all the other members in [[Phosphatase_Family_PTP|PTP family]]. PTPRQ has low phosphatase activity against tyrosine-phosphorylated peptide and protein substrates but can dephosphorylate a broad range of phosphatidylinositol phosphates, including phosphatidylinositol 3,4,5-trisphosphate and most phosphatidylinositol monophosphates and diphosphates, with a preference for PI(3,4,5)P3 &amp;lt;cite&amp;gt;Yu13&amp;lt;/cite&amp;gt;. This shift in activity correlates with a change of the WPD tyrosine-specific motif to WPE. Overexpression of PTPRQ in cultured cells inhibits proliferation and induces apoptosis. An E2171D mutation that retains or increases tyrosine phosphatase activity but eliminates phosphatidylinositol phosphatase activity, eliminates the inhibitory effects on proliferation and apoptosis. &lt;br /&gt;
&lt;br /&gt;
Mutations in PTPRQ can cause hearing impairment (DFNB84), including one missense mutation in an FN3 domain and a nonsense mutation early in the extracellular region  &amp;lt;cite&amp;gt;Shahin10, Schraders10&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
PTPRQ has also been shown to involved in differentiation during adipogenesis of human mesenchymal stem cells &amp;lt;cite&amp;gt;Jung09&amp;lt;/cite&amp;gt; and regulation the adhesion and migration of mesangial cells in response to injury &amp;lt;cite&amp;gt;Wright98&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
PTPRQ is seen in all vertebrates, and a likely ortholog (XP_002123247.3) also exists in Ciona intestinalis.&lt;br /&gt;
&lt;br /&gt;
===References===&lt;br /&gt;
&amp;lt;biblio&amp;gt;&lt;br /&gt;
#Adamsky01 pmid=11313993&lt;br /&gt;
#Aguiar99 pmid=10498613&lt;br /&gt;
#Arora11 pmid=21262971&lt;br /&gt;
#Autschbach99 pmid=10599888&lt;br /&gt;
#AyaBonilla13 pmid=23341091&lt;br /&gt;
#Baker01 pmid=11259588&lt;br /&gt;
#Balavenkatraman06 pmid=16682945&lt;br /&gt;
#Behjati14 pmid=24633157&lt;br /&gt;
#Berset05 pmid=15901674&lt;br /&gt;
#Bohmer13 pmid=23650535&lt;br /&gt;
#Brunner11 pmid=21304107&lt;br /&gt;
#Chabot09 pmid=18936167&lt;br /&gt;
#Chen06 pmid=16888096&lt;br /&gt;
#Fachinger99 pmid=10557082&lt;br /&gt;
#Fiorillo04 pmid=20538612&lt;br /&gt;
#Garwood03 pmid=12700241&lt;br /&gt;
#Godfrey12 pmid=22438257&lt;br /&gt;
#Holsinger02 pmid=12370829&lt;br /&gt;
#Hower09 pmid=19573017&lt;br /&gt;
#Huang13 pmid=24090193&lt;br /&gt;
#Hsu13 pmid=23533167&lt;br /&gt;
#Iervolino06 pmid=16778204&lt;br /&gt;
#Ito03 pmid=12837766&lt;br /&gt;
#Iuliano04 pmid=15378013&lt;br /&gt;
#Jeon pmid=19675131&lt;br /&gt;
#Jung09 pmid=19351528&lt;br /&gt;
#Kovalenko00 pmid=10821867&lt;br /&gt;
#Kruger15 pmid=25830095&lt;br /&gt;
#Wright98 pmid=9727007&lt;br /&gt;
#Massa04 pmid=15123617&lt;br /&gt;
#Motiwala04 pmid=15356345&lt;br /&gt;
#Motiwala07 pmid=17545520&lt;br /&gt;
#Motiwala09 pmid=18997174&lt;br /&gt;
#Motiwala10 pmid=20564182&lt;br /&gt;
#Matozaki94 pmid=8294459&lt;br /&gt;
#Mellberg09 pmid=19136612&lt;br /&gt;
#Meng00 pmid=10706604&lt;br /&gt;
#Mori10 pmid=20301196&lt;br /&gt;
#Nagano03 pmid=12879010&lt;br /&gt;
#Noguchi01 pmid=11278335&lt;br /&gt;
#Nawroth02 pmid=12234928&lt;br /&gt;
#Omerovic10 pmid=19922411&lt;br /&gt;
#Ozaltin11 pmid=21722858&lt;br /&gt;
#Palka03 pmid=12475979&lt;br /&gt;
#Petermann11 pmid=21091576&lt;br /&gt;
#Pera05 pmid=15735685&lt;br /&gt;
#Persson02 pmid=12062403&lt;br /&gt;
#Pixley95 pmid=7592997&lt;br /&gt;
#Pixley01 pmid=11238916&lt;br /&gt;
#Ramaswamy09 pmid=19095770&lt;br /&gt;
#Sacco09 pmid=19494114&lt;br /&gt;
#Sallee09 pmid=19122201&lt;br /&gt;
#Schraders10 pmid=20346435&lt;br /&gt;
#Seifert03 pmid=12837292&lt;br /&gt;
#Shen14 pmid=25180601&lt;br /&gt;
#Shahin10 pmid=20472657&lt;br /&gt;
#Shintani15 pmid=26063811&lt;br /&gt;
#Smart12 pmid=22815804&lt;br /&gt;
#Spring15 pmid=25772245&lt;br /&gt;
#Stepanek11 pmid=21543337&lt;br /&gt;
#Takada02 pmid=12101188&lt;br /&gt;
#Takahashi12 pmid=22308318&lt;br /&gt;
#Tangye98 pmid=9759839&lt;br /&gt;
#Tarcic09 pmid=19836242&lt;br /&gt;
#Trapasso04 pmid=15231692&lt;br /&gt;
#Tsuboi08 pmid=18348712&lt;br /&gt;
#Venkatachalam10 pmid=21036128&lt;br /&gt;
#Whiteford11 pmid=21813734&lt;br /&gt;
#Wiggins95 pmid=7665166&lt;br /&gt;
#Winderlich09 pmid=19451274&lt;br /&gt;
#Xu14 pmid=25034527&lt;br /&gt;
#Yacyshyn09 pmid=19116766&lt;br /&gt;
#You12 pmid=22099875&lt;br /&gt;
#Yu12 pmid=22851698&lt;br /&gt;
#Yu13 pmid=23897475&lt;br /&gt;
&amp;lt;/biblio&amp;gt;&lt;/div&gt;</summary>
		<author><name>Mark</name></author>	</entry>

	<entry>
		<id>http://www.phosphatome.net/wiki/index.php/Phosphatase_Subfamily_PPP7C</id>
		<title>Phosphatase Subfamily PPP7C</title>
		<link rel="alternate" type="text/html" href="http://www.phosphatome.net/wiki/index.php/Phosphatase_Subfamily_PPP7C"/>
				<updated>2017-01-06T13:55:12Z</updated>
		
		<summary type="html">&lt;p&gt;Mark: /* References */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;__NOTOC__&lt;br /&gt;
[[Phosphatase classification|Phosphatase Classification]]: [[Phosphatase_Fold_PPPL|Fold PPPL]]: [[Phosphatase_Superfamily_PPPL|Superfamily PPPL]]: [[Phosphatase_Family_PPPc|Family PPPc]]: [[Phosphatase_Subfamily_PPP7C|Subfamily PPP7C]]&lt;br /&gt;
 Note: the page is under construction.&lt;br /&gt;
&lt;br /&gt;
=== Evolution ===&lt;br /&gt;
The PPP7C subfamily is found in eumetazoa and Placozoa ''Trichoplax adhaerens'', but it is not present in sponge. &lt;br /&gt;
&lt;br /&gt;
=== Domain ===&lt;br /&gt;
PPP7Cs typically have a domain combination of [[Protein_Domain#IQ|IQ calmodulin-binding motif]], [[Protein_Domain#TPR|TPR structural motif]] mediating protein-protein interaction, PPP phosphatase domain, and tandem [[Protein_Domain#EF_hand|EF hand structural motifs]] binding to calcium. The domain combination makes it easier and more confident to identify PPP7Cs. Drosophila melanogaster PPP7C, rdgC, has two TPR motifs.&lt;br /&gt;
&lt;br /&gt;
=== Functions ===&lt;br /&gt;
Human has two members in PPP7C subfamily, PPEF1 (PPP7CA) and PPEF2 (PPP7CB).&lt;br /&gt;
&lt;br /&gt;
==== PPEF1 (PPP7CA) ====&lt;br /&gt;
&lt;br /&gt;
PPEF-1 interacts with and dephosphorylates Programmed cell death 5 (PDCD5) at Ser-119, which leads to PDCD5 destabilization.  It is believed to play a crucial role in p53 activation &amp;lt;cite&amp;gt;Park2017&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
=== References ===&lt;br /&gt;
&amp;lt;biblio&amp;gt;&lt;br /&gt;
#Park2017 pmid=28051100&lt;br /&gt;
&amp;lt;/biblio&amp;gt;&lt;/div&gt;</summary>
		<author><name>Mark</name></author>	</entry>

	<entry>
		<id>http://www.phosphatome.net/wiki/index.php/Phosphatase_Subfamily_PPP7C</id>
		<title>Phosphatase Subfamily PPP7C</title>
		<link rel="alternate" type="text/html" href="http://www.phosphatome.net/wiki/index.php/Phosphatase_Subfamily_PPP7C"/>
				<updated>2017-01-06T13:54:56Z</updated>
		
		<summary type="html">&lt;p&gt;Mark: /* Functions */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;__NOTOC__&lt;br /&gt;
[[Phosphatase classification|Phosphatase Classification]]: [[Phosphatase_Fold_PPPL|Fold PPPL]]: [[Phosphatase_Superfamily_PPPL|Superfamily PPPL]]: [[Phosphatase_Family_PPPc|Family PPPc]]: [[Phosphatase_Subfamily_PPP7C|Subfamily PPP7C]]&lt;br /&gt;
 Note: the page is under construction.&lt;br /&gt;
&lt;br /&gt;
=== Evolution ===&lt;br /&gt;
The PPP7C subfamily is found in eumetazoa and Placozoa ''Trichoplax adhaerens'', but it is not present in sponge. &lt;br /&gt;
&lt;br /&gt;
=== Domain ===&lt;br /&gt;
PPP7Cs typically have a domain combination of [[Protein_Domain#IQ|IQ calmodulin-binding motif]], [[Protein_Domain#TPR|TPR structural motif]] mediating protein-protein interaction, PPP phosphatase domain, and tandem [[Protein_Domain#EF_hand|EF hand structural motifs]] binding to calcium. The domain combination makes it easier and more confident to identify PPP7Cs. Drosophila melanogaster PPP7C, rdgC, has two TPR motifs.&lt;br /&gt;
&lt;br /&gt;
=== Functions ===&lt;br /&gt;
Human has two members in PPP7C subfamily, PPEF1 (PPP7CA) and PPEF2 (PPP7CB).&lt;br /&gt;
&lt;br /&gt;
==== PPEF1 (PPP7CA) ====&lt;br /&gt;
&lt;br /&gt;
PPEF-1 interacts with and dephosphorylates Programmed cell death 5 (PDCD5) at Ser-119, which leads to PDCD5 destabilization.  It is believed to play a crucial role in p53 activation &amp;lt;cite&amp;gt;Park2017&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
=== References ===&lt;br /&gt;
&amp;lt;biblio&amp;gt;&lt;br /&gt;
&amp;lt;/biblio&amp;gt;&lt;/div&gt;</summary>
		<author><name>Mark</name></author>	</entry>

	<entry>
		<id>http://www.phosphatome.net/wiki/index.php/Phosphatase_Subfamily_PPP3C</id>
		<title>Phosphatase Subfamily PPP3C</title>
		<link rel="alternate" type="text/html" href="http://www.phosphatome.net/wiki/index.php/Phosphatase_Subfamily_PPP3C"/>
				<updated>2017-01-03T17:39:54Z</updated>
		
		<summary type="html">&lt;p&gt;Mark: /* PPP3CC */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;__NOTOC__&lt;br /&gt;
[[Phosphatase classification|Phosphatase Classification]]: [[Phosphatase_Fold_MTDP|Fold MTDP]]: [[Phosphatase_Superfamily_MTDP|Superfamily MTDP]]: [[Phosphatase_Family_PPP|Family PPP]]: [[Phosphatase_Subfamily_PPP3C|Subfamily PPP3C]] (PP2B, calcineurin)&lt;br /&gt;
&lt;br /&gt;
PPP3C, the catalytic subunit of PP2B (calcineurin) holoeynzme, is a calcium-dependent serine/threonine phosphatase conserved in eukaryotes. It is involved in various biological processes and has significantly clinic relevance.&lt;br /&gt;
&lt;br /&gt;
=== Evolution ===&lt;br /&gt;
PPP3C is found throughout eukaryotes, including [[Phosphatase_Glossary#Opisthokonta|opisthokonta]], amoebazoa, plants and etc.&lt;br /&gt;
&lt;br /&gt;
=== Domain ===&lt;br /&gt;
PPP3C has a single domain - phosphatase domain.&lt;br /&gt;
&lt;br /&gt;
=== Functions ===&lt;br /&gt;
PPP3C is the catalytic subunit of Protein Phosphatase 2B (PP2B) holoenzyme (aka calcineurin).  The holoenzyme is heterodimer complex consisting of one catalytic subunit and one regulatory subunit participates in very various cellular processes, from cell cycle progression to cardiac hypertrophy &amp;lt;cite&amp;gt;Rusnak00&amp;lt;/cite&amp;gt;. Below are some examples of its function:&lt;br /&gt;
&lt;br /&gt;
* PP2B (calcineurin) activates the T cells of the immune system in mammals. When an antigen-preseting cell interacts with a T cell receptor on T cells, the cytoplasmic level of calcium increases, which activates calcineurin. PP2B (calcineurin) is used as a target for several immunosuppressive drugs, e.g. [http://en.wikipedia.org/wiki/Tacrolimus tacrolimus] which is an immunosuppressive drug used mainly after allogeneic organ transplant to reduce the activity of the patient's immune system and so lower the risk of organ rejection &amp;lt;cite&amp;gt;Wang15&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
* PP2B (calcineurin) is  included as a key player in mediating calcium-triggered and -accelerated vesicle endocytosis &amp;lt;cite&amp;gt;Wu14&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
* PP2B (calcineurin) activates a vertebrate-specific transcription factor called NFATc. &lt;br /&gt;
&lt;br /&gt;
* PPP3C (PP2B, calcineurin) modulates potassium channel, perhaps by directly controlling the phosphorylation state of potassium channel in collaboration with PKA &amp;lt;cite&amp;gt;Orie09, Brignell15&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
* PPP3C interacts with Nuclear factor (NF)-κB-inducing kinase (NIK) and attenuates NIK-dependent gene expression &amp;lt;cite&amp;gt;Shinzawa15&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
* In fission yeast, calcineurin interacts with and dephosphorylates kinase Cki3, belonging to CK1-G subfamily, CK1 family, CK1 group. Cki3 autophosphorylate itself in the C terminus, which result in the inhibition of its kinase activity &amp;lt;cite&amp;gt; Koyano15&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
This phosphatase has clinical significance for schizophrenia and diabetes (see [http://en.wikipedia.org/wiki/Calcineurin wikipedia]). &lt;br /&gt;
&lt;br /&gt;
Besides, PPP3C (PP2B, calcineurin) is an attractive antifungal drug target &amp;lt;cite&amp;gt; Matsoukas15&amp;lt;/cite&amp;gt;, and its inhibitor (FK506 or cyclosporin A) can be combined with azoles or echinocandins for use against multidrug-resistant Candida species &amp;lt;cite&amp;gt;Yu15&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
==== PPP3CC ====&lt;br /&gt;
&lt;br /&gt;
PPP3CC is a component of a constitutive intrinsic inflammatory signaling circuit composed of miR-196b, Meis2, PPP3CC, and p65. The signaling circuit drives prostate cancer castration resistance &amp;lt;cite&amp;gt;Jeong2016&amp;lt;/cite&amp;gt; (Entitled A Constitutive Intrinsic Inflammatory Signaling Circuit Composed of miR-196b, Meis2, PPP3CC, and p65 Drives Prostate Cancer Castration Resistance).&lt;br /&gt;
&lt;br /&gt;
=== References ===&lt;br /&gt;
&amp;lt;biblio&amp;gt;&lt;br /&gt;
#Brignell15 pmid=25793374&lt;br /&gt;
#Koyano15 pmid=25691662&lt;br /&gt;
#Matsoukas15 pmid=26106221&lt;br /&gt;
#Orie09 pmid=19422382&lt;br /&gt;
#Rusnak00 pmid=11015619&lt;br /&gt;
#Shinzawa15 pmid=26029823&lt;br /&gt;
#Wang15 pmid=25452304&lt;br /&gt;
#Wu14 pmid=24835995&lt;br /&gt;
#Yu15 pmid=25878052&lt;br /&gt;
&amp;lt;/biblio&amp;gt;&lt;/div&gt;</summary>
		<author><name>Mark</name></author>	</entry>

	<entry>
		<id>http://www.phosphatome.net/wiki/index.php/Phosphatase_Subfamily_PPP3C</id>
		<title>Phosphatase Subfamily PPP3C</title>
		<link rel="alternate" type="text/html" href="http://www.phosphatome.net/wiki/index.php/Phosphatase_Subfamily_PPP3C"/>
				<updated>2017-01-03T17:38:08Z</updated>
		
		<summary type="html">&lt;p&gt;Mark: /* Functions */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;__NOTOC__&lt;br /&gt;
[[Phosphatase classification|Phosphatase Classification]]: [[Phosphatase_Fold_MTDP|Fold MTDP]]: [[Phosphatase_Superfamily_MTDP|Superfamily MTDP]]: [[Phosphatase_Family_PPP|Family PPP]]: [[Phosphatase_Subfamily_PPP3C|Subfamily PPP3C]] (PP2B, calcineurin)&lt;br /&gt;
&lt;br /&gt;
PPP3C, the catalytic subunit of PP2B (calcineurin) holoeynzme, is a calcium-dependent serine/threonine phosphatase conserved in eukaryotes. It is involved in various biological processes and has significantly clinic relevance.&lt;br /&gt;
&lt;br /&gt;
=== Evolution ===&lt;br /&gt;
PPP3C is found throughout eukaryotes, including [[Phosphatase_Glossary#Opisthokonta|opisthokonta]], amoebazoa, plants and etc.&lt;br /&gt;
&lt;br /&gt;
=== Domain ===&lt;br /&gt;
PPP3C has a single domain - phosphatase domain.&lt;br /&gt;
&lt;br /&gt;
=== Functions ===&lt;br /&gt;
PPP3C is the catalytic subunit of Protein Phosphatase 2B (PP2B) holoenzyme (aka calcineurin).  The holoenzyme is heterodimer complex consisting of one catalytic subunit and one regulatory subunit participates in very various cellular processes, from cell cycle progression to cardiac hypertrophy &amp;lt;cite&amp;gt;Rusnak00&amp;lt;/cite&amp;gt;. Below are some examples of its function:&lt;br /&gt;
&lt;br /&gt;
* PP2B (calcineurin) activates the T cells of the immune system in mammals. When an antigen-preseting cell interacts with a T cell receptor on T cells, the cytoplasmic level of calcium increases, which activates calcineurin. PP2B (calcineurin) is used as a target for several immunosuppressive drugs, e.g. [http://en.wikipedia.org/wiki/Tacrolimus tacrolimus] which is an immunosuppressive drug used mainly after allogeneic organ transplant to reduce the activity of the patient's immune system and so lower the risk of organ rejection &amp;lt;cite&amp;gt;Wang15&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
* PP2B (calcineurin) is  included as a key player in mediating calcium-triggered and -accelerated vesicle endocytosis &amp;lt;cite&amp;gt;Wu14&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
* PP2B (calcineurin) activates a vertebrate-specific transcription factor called NFATc. &lt;br /&gt;
&lt;br /&gt;
* PPP3C (PP2B, calcineurin) modulates potassium channel, perhaps by directly controlling the phosphorylation state of potassium channel in collaboration with PKA &amp;lt;cite&amp;gt;Orie09, Brignell15&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
* PPP3C interacts with Nuclear factor (NF)-κB-inducing kinase (NIK) and attenuates NIK-dependent gene expression &amp;lt;cite&amp;gt;Shinzawa15&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
* In fission yeast, calcineurin interacts with and dephosphorylates kinase Cki3, belonging to CK1-G subfamily, CK1 family, CK1 group. Cki3 autophosphorylate itself in the C terminus, which result in the inhibition of its kinase activity &amp;lt;cite&amp;gt; Koyano15&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
This phosphatase has clinical significance for schizophrenia and diabetes (see [http://en.wikipedia.org/wiki/Calcineurin wikipedia]). &lt;br /&gt;
&lt;br /&gt;
Besides, PPP3C (PP2B, calcineurin) is an attractive antifungal drug target &amp;lt;cite&amp;gt; Matsoukas15&amp;lt;/cite&amp;gt;, and its inhibitor (FK506 or cyclosporin A) can be combined with azoles or echinocandins for use against multidrug-resistant Candida species &amp;lt;cite&amp;gt;Yu15&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
==== PPP3CC ====&lt;br /&gt;
&lt;br /&gt;
PPP3CC is a component of a constitutive intrinsic inflammatory signaling circuit composed of miR-196b, Meis2, PPP3CC, and p65. The signaling circuit drives prostate cancer castration resistance &amp;lt;cite&amp;gt;Jeong2016&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
=== References ===&lt;br /&gt;
&amp;lt;biblio&amp;gt;&lt;br /&gt;
#Brignell15 pmid=25793374&lt;br /&gt;
#Koyano15 pmid=25691662&lt;br /&gt;
#Matsoukas15 pmid=26106221&lt;br /&gt;
#Orie09 pmid=19422382&lt;br /&gt;
#Rusnak00 pmid=11015619&lt;br /&gt;
#Shinzawa15 pmid=26029823&lt;br /&gt;
#Wang15 pmid=25452304&lt;br /&gt;
#Wu14 pmid=24835995&lt;br /&gt;
#Yu15 pmid=25878052&lt;br /&gt;
&amp;lt;/biblio&amp;gt;&lt;/div&gt;</summary>
		<author><name>Mark</name></author>	</entry>

	<entry>
		<id>http://www.phosphatome.net/wiki/index.php/Wiki_Management</id>
		<title>Wiki Management</title>
		<link rel="alternate" type="text/html" href="http://www.phosphatome.net/wiki/index.php/Wiki_Management"/>
				<updated>2016-11-10T21:16:45Z</updated>
		
		<summary type="html">&lt;p&gt;Mark: Created page with &amp;quot;=== Citations ===  We use BiblioPlus for automated retrieval and formatting of citations from PubMed and the ISBN databases.   However, it failed in Nov, 2016, because [https:...&amp;quot;&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;=== Citations ===&lt;br /&gt;
&lt;br /&gt;
We use BiblioPlus for automated retrieval and formatting of citations from PubMed and the ISBN databases. &lt;br /&gt;
&lt;br /&gt;
However, it failed in Nov, 2016, because [https://www.ncbi.nlm.nih.gov/home/develop/https-guidance.shtml NCBI switched from http to https]. Since the latest version (1.27) does not solve the problem, we changed &amp;quot;http&amp;quot; to &amp;quot;https&amp;quot; in the scripts, found by the command &amp;quot;grep http *&amp;quot; in the extension directory. The problem was then solved.&lt;/div&gt;</summary>
		<author><name>Mark</name></author>	</entry>

	<entry>
		<id>http://www.phosphatome.net/wiki/index.php/Main_Page</id>
		<title>Main Page</title>
		<link rel="alternate" type="text/html" href="http://www.phosphatome.net/wiki/index.php/Main_Page"/>
				<updated>2016-11-10T21:10:16Z</updated>
		
		<summary type="html">&lt;p&gt;Mark: /* Technical notes */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;__NOTOC__&lt;br /&gt;
Welcome to Phosphatase Wiki, a resource for phosphatases and phosphatase signaling focused on genomics and evolution. This is a pilot project for sharing and publication of discoveries that do not fit into traditional publications or haven't yet been polished for publication. Initial content is mostly from the Manning lab at Salk (moved to Genentech in 2012), but we welcome anyone who would like to contribute. Like other wikis, just go to the login page to request an account.&lt;br /&gt;
&lt;br /&gt;
== [[Introduction to Phosphatases]] ==&lt;br /&gt;
* [[Phosphatases_and_Diseases|Phosphatases and diseases]] &lt;br /&gt;
* [[Drug_Targeting_Phosphatases|Phosphatases as drug and/or inhibitor targets]] &lt;br /&gt;
* [[Biological_Significance_of_Phosphorylation|Miscellaneous biological and clinic significance of phosphorylation]]&lt;br /&gt;
* [[Dephosphorylation_on_unusual_amino_acids|(De)phosphorylation on unusual amino acids]]: unusual evidence for phosphorylation on histidine, aspartate, cysteine, lysine, and arginine.&lt;br /&gt;
* [[regulatory_subunits|Regulatory subunits]]: some phosphatases, particularly PPPs, consist of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits.&lt;br /&gt;
&lt;br /&gt;
== [[phosphatase classification|Protein Phosphatase Classification and Evolution]] ==&lt;br /&gt;
===== [[Phosphatase_classification#Classification_Chart_of_Protein_Phosphatases|Classification chart]] =====&lt;br /&gt;
In contrast with kinases, there are multiple folds of protein phosphatases, which means protein phosphatases have multiple independent evolutionary origins, while most kinases have a single origin. We classified protein phosphatases into a hierarchy scheme of four levels: fold, superfamily, family and subfamily.&lt;br /&gt;
&lt;br /&gt;
===== [[Pseudophosphatases|Catalytically inactive phosphatases]] (pseudophosphatases) =====&lt;br /&gt;
Protein phosphatases have various functions. Some protein phosphatases lack catalytically activity, but them play critical roles in various cellular signaling pathways.&lt;br /&gt;
&lt;br /&gt;
===== Protein phosphatase evolution =====&lt;br /&gt;
Each of the protein phosphatase fold are able to be found in early eukaryotes, so are most of the protein phosphatase families. The subfamilies have a dynamic evolutionary pattern. Some subfamilies have been lost multiple times through independent evolutionary events. While many subfamilies expanded in gene number in vertebrates, some subfamily has a single member in almost all the sequenced eukaryotic genomes. Protein phosphatase also underwent [[Accesory_Domain_Gains_and_Losses|gains and losses of accessory domain]].&lt;br /&gt;
&lt;br /&gt;
===== [[Human_Protein_Phosphatase_Pseudogene|Human protein phosphatase pseudogenes]] =====&lt;br /&gt;
There are about 80 pseudogenes which originated from the protein-coding genes that encode protein phosphatases in human. They are functional at least in some cases. For instance, PTENP1 is a processed pseudogene of PTEN and regulates PTEN by both sense and antisense RNAs.&lt;br /&gt;
&lt;br /&gt;
== Glossary ==&lt;br /&gt;
* [[Phosphatase_Glossary|Miscellaneous]]&lt;br /&gt;
* [[Protein_Domain|Protein domain and motif]]&lt;br /&gt;
* [[Signaling_Pathway_And_Proteins|Signaling pathways and proteins]]&lt;br /&gt;
&lt;br /&gt;
== Technical notes ==&lt;br /&gt;
* [[Phosphatome_Computational_Tools_and_Resources|Phosphatome computational tools and resources]]&lt;br /&gt;
* [[Notes_of_Sequenced_Genomes|Notes of Sequenced Genomes]]&lt;br /&gt;
* [[HMM|HMMs]]&lt;br /&gt;
* [[Wiki_Management|Wiki Management]]&lt;/div&gt;</summary>
		<author><name>Mark</name></author>	</entry>

	<entry>
		<id>http://www.phosphatome.net/wiki/index.php/Main_Page</id>
		<title>Main Page</title>
		<link rel="alternate" type="text/html" href="http://www.phosphatome.net/wiki/index.php/Main_Page"/>
				<updated>2016-11-10T21:10:00Z</updated>
		
		<summary type="html">&lt;p&gt;Mark: /* Technical notes */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;__NOTOC__&lt;br /&gt;
Welcome to Phosphatase Wiki, a resource for phosphatases and phosphatase signaling focused on genomics and evolution. This is a pilot project for sharing and publication of discoveries that do not fit into traditional publications or haven't yet been polished for publication. Initial content is mostly from the Manning lab at Salk (moved to Genentech in 2012), but we welcome anyone who would like to contribute. Like other wikis, just go to the login page to request an account.&lt;br /&gt;
&lt;br /&gt;
== [[Introduction to Phosphatases]] ==&lt;br /&gt;
* [[Phosphatases_and_Diseases|Phosphatases and diseases]] &lt;br /&gt;
* [[Drug_Targeting_Phosphatases|Phosphatases as drug and/or inhibitor targets]] &lt;br /&gt;
* [[Biological_Significance_of_Phosphorylation|Miscellaneous biological and clinic significance of phosphorylation]]&lt;br /&gt;
* [[Dephosphorylation_on_unusual_amino_acids|(De)phosphorylation on unusual amino acids]]: unusual evidence for phosphorylation on histidine, aspartate, cysteine, lysine, and arginine.&lt;br /&gt;
* [[regulatory_subunits|Regulatory subunits]]: some phosphatases, particularly PPPs, consist of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits.&lt;br /&gt;
&lt;br /&gt;
== [[phosphatase classification|Protein Phosphatase Classification and Evolution]] ==&lt;br /&gt;
===== [[Phosphatase_classification#Classification_Chart_of_Protein_Phosphatases|Classification chart]] =====&lt;br /&gt;
In contrast with kinases, there are multiple folds of protein phosphatases, which means protein phosphatases have multiple independent evolutionary origins, while most kinases have a single origin. We classified protein phosphatases into a hierarchy scheme of four levels: fold, superfamily, family and subfamily.&lt;br /&gt;
&lt;br /&gt;
===== [[Pseudophosphatases|Catalytically inactive phosphatases]] (pseudophosphatases) =====&lt;br /&gt;
Protein phosphatases have various functions. Some protein phosphatases lack catalytically activity, but them play critical roles in various cellular signaling pathways.&lt;br /&gt;
&lt;br /&gt;
===== Protein phosphatase evolution =====&lt;br /&gt;
Each of the protein phosphatase fold are able to be found in early eukaryotes, so are most of the protein phosphatase families. The subfamilies have a dynamic evolutionary pattern. Some subfamilies have been lost multiple times through independent evolutionary events. While many subfamilies expanded in gene number in vertebrates, some subfamily has a single member in almost all the sequenced eukaryotic genomes. Protein phosphatase also underwent [[Accesory_Domain_Gains_and_Losses|gains and losses of accessory domain]].&lt;br /&gt;
&lt;br /&gt;
===== [[Human_Protein_Phosphatase_Pseudogene|Human protein phosphatase pseudogenes]] =====&lt;br /&gt;
There are about 80 pseudogenes which originated from the protein-coding genes that encode protein phosphatases in human. They are functional at least in some cases. For instance, PTENP1 is a processed pseudogene of PTEN and regulates PTEN by both sense and antisense RNAs.&lt;br /&gt;
&lt;br /&gt;
== Glossary ==&lt;br /&gt;
* [[Phosphatase_Glossary|Miscellaneous]]&lt;br /&gt;
* [[Protein_Domain|Protein domain and motif]]&lt;br /&gt;
* [[Signaling_Pathway_And_Proteins|Signaling pathways and proteins]]&lt;br /&gt;
&lt;br /&gt;
== Technical notes ==&lt;br /&gt;
* [[Phosphatome_Computational_Tools_and_Resources|Phosphatome computational tools and resources]]&lt;br /&gt;
* [[Notes_of_Sequenced_Genomes|Notes of Sequenced Genomes]]&lt;br /&gt;
* [[HMM|HMMs]]&lt;br /&gt;
* [[Management|Management]]&lt;/div&gt;</summary>
		<author><name>Mark</name></author>	</entry>

	<entry>
		<id>http://www.phosphatome.net/wiki/index.php/Phosphatase_Subfamily_YMR1</id>
		<title>Phosphatase Subfamily YMR1</title>
		<link rel="alternate" type="text/html" href="http://www.phosphatome.net/wiki/index.php/Phosphatase_Subfamily_YMR1"/>
				<updated>2016-09-09T14:56:21Z</updated>
		
		<summary type="html">&lt;p&gt;Mark: /* References */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;__NOTOC__&lt;br /&gt;
&lt;br /&gt;
[[Phosphatase classification|Phosphatase Classification]]: [[Phosphatase_Fold_CC1|Fold CC1]]: [[Phosphatase_Superfamily_CC1|Superfamily CC1]]:  [[Phosphatase_Family_Myotubularin|Family Myotubularin]]: [[Phosphatase_Subfamily_YMR1|Subfamily YMR1]]&lt;br /&gt;
&lt;br /&gt;
YMR1 encodes PI(3)P phosphatase found in fungi &amp;lt;cite&amp;gt;taylor00&amp;lt;/cite&amp;gt;. It is the single myotubularin in most fungi.&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
YMR1 is found in most fungi.&lt;br /&gt;
&lt;br /&gt;
===Domain Structure===&lt;br /&gt;
YMR1 subfamily has three domains: [http://pfam.xfam.org/family/PF02893.15 PH/GRAM], phosphatase domain and coiled-coil domain. The GRAM domain is similar to PH domain in structure and is found in membrane-associated proteins.&lt;br /&gt;
&lt;br /&gt;
===Catalytic activity and functions===&lt;br /&gt;
YMR1 of budding yeast encodes PI(3)P phosphatase, so does its ortholog in fission yeast  &amp;lt;cite&amp;gt;taylor00, blondeau00&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===References===&lt;br /&gt;
&amp;lt;biblio&amp;gt;&lt;br /&gt;
#taylor00 pmid=10900271&lt;br /&gt;
#blondeau00 pmid=11001925&lt;br /&gt;
&amp;lt;/biblio&amp;gt;&lt;/div&gt;</summary>
		<author><name>Mark</name></author>	</entry>

	<entry>
		<id>http://www.phosphatome.net/wiki/index.php/Phosphatase_Subfamily_YMR1</id>
		<title>Phosphatase Subfamily YMR1</title>
		<link rel="alternate" type="text/html" href="http://www.phosphatome.net/wiki/index.php/Phosphatase_Subfamily_YMR1"/>
				<updated>2016-09-09T14:56:07Z</updated>
		
		<summary type="html">&lt;p&gt;Mark: /* Catalytic activity and functions */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;__NOTOC__&lt;br /&gt;
&lt;br /&gt;
[[Phosphatase classification|Phosphatase Classification]]: [[Phosphatase_Fold_CC1|Fold CC1]]: [[Phosphatase_Superfamily_CC1|Superfamily CC1]]:  [[Phosphatase_Family_Myotubularin|Family Myotubularin]]: [[Phosphatase_Subfamily_YMR1|Subfamily YMR1]]&lt;br /&gt;
&lt;br /&gt;
YMR1 encodes PI(3)P phosphatase found in fungi &amp;lt;cite&amp;gt;taylor00&amp;lt;/cite&amp;gt;. It is the single myotubularin in most fungi.&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
YMR1 is found in most fungi.&lt;br /&gt;
&lt;br /&gt;
===Domain Structure===&lt;br /&gt;
YMR1 subfamily has three domains: [http://pfam.xfam.org/family/PF02893.15 PH/GRAM], phosphatase domain and coiled-coil domain. The GRAM domain is similar to PH domain in structure and is found in membrane-associated proteins.&lt;br /&gt;
&lt;br /&gt;
===Catalytic activity and functions===&lt;br /&gt;
YMR1 of budding yeast encodes PI(3)P phosphatase, so does its ortholog in fission yeast  &amp;lt;cite&amp;gt;taylor00, blondeau00&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===References===&lt;br /&gt;
&amp;lt;biblio&amp;gt;&lt;br /&gt;
#taylor00 pmid=10900271&lt;br /&gt;
&amp;lt;/biblio&amp;gt;&lt;/div&gt;</summary>
		<author><name>Mark</name></author>	</entry>

	<entry>
		<id>http://www.phosphatome.net/wiki/index.php/Phosphatase_Subfamily_MTMR1</id>
		<title>Phosphatase Subfamily MTMR1</title>
		<link rel="alternate" type="text/html" href="http://www.phosphatome.net/wiki/index.php/Phosphatase_Subfamily_MTMR1"/>
				<updated>2016-09-09T14:54:03Z</updated>
		
		<summary type="html">&lt;p&gt;Mark: /* Catalytic activity and functions */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;__NOTOC__&lt;br /&gt;
&lt;br /&gt;
[[Phosphatase classification|Phosphatase Classification]]: [[Phosphatase_Fold_CC1|Fold CC1]]: [[Phosphatase_Superfamily_CC1|Superfamily CC1]]:  [[Phosphatase_Family_Myotubularin|Family Myotubularin]]: [[Phosphatase_Subfamily_MTMR1|Subfamily MTMR1]]&lt;br /&gt;
&lt;br /&gt;
MTMR1 is a lipid phosphatase that dephosphorylates the second messenger phosphatidylinositol 3-monophosphate [PI(3)P].&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
MTMR1 is found throughout holozoa. It consists of three members in human, MTM1, MTMR1 and MTMR2. In fruit fly and C elegans, a single copy is found. In most vertebrates from fish to human, MTM1 and MTMR1 are adjacent on the X chromosome (see [http://www.genomicus.biologie.ens.fr/genomicus-78.01/cgi-bin/phyloview.pl?root=2198950&amp;amp;amp;id=2199015&amp;amp;amp;xhide=108:107:105:110:69:96:97:63:111:-2198950:94:92:82:115:76:46:48:57:56:67:112:78:61:3:99:52:24:81:58:10:55:83&amp;amp;amp;xcollapse=-2198950&amp;amp;amp; Genomicus]).&lt;br /&gt;
&lt;br /&gt;
===Domain Structure===&lt;br /&gt;
MTMR1 has a [http://pfam.xfam.org/family/PF02893.15 GRAM] domain, phosphatase domain and coiled-coil region. The GRAM domain is similar to the PH domain in structure and is found in membrane-associated proteins. As shown in [[Phosphatase_Subfamily_MTMR3|MTMR3 subfamily]], the GRAM domain can bind to phosphoinositide lipids. The coiled-coil domain has been shown to mediate the interaction between [[Phosphatase_Gene_MTMR2|MTMR2]] and the [[Phosphatase_Subfamily_MTMR5|MTMR5 subfamily]] members MTMR13 and MTMR5 in human &amp;lt;cite&amp;gt;kim03, robinson05&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Catalytic activity and functions===&lt;br /&gt;
Human MTM1 has phosphatase activity towards the second messenger phosphatidylinositol 3-monophosphate [PI(3)P] in vitro and in human &amp;lt;cite&amp;gt;taylor00, blondeau00&amp;lt;/cite&amp;gt;.&lt;br /&gt;
Human MTMR1 and MTMR2 have been shown to dephosphorylate PI(3)P (&amp;lt;cite&amp;gt;bujbello02&amp;lt;/cite&amp;gt; and &amp;lt;cite&amp;gt;kim01&amp;lt;/cite&amp;gt;, respectively). Although the enzymatic properties of the three human phosphatases are indistinguishable, their functions are not totally redundant. MTM1 and MTMR2 are differentially regulated in the aspects of developmental expression and subcellular localization, resulting in their use of specific cellular pools of PI(3)P &amp;lt;cite&amp;gt;kim01&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Related Kinases===&lt;br /&gt;
See [http://en.wikipedia.org/wiki/Phosphoinositide_3-kinase PI3K].&lt;br /&gt;
&lt;br /&gt;
===References===&lt;br /&gt;
&amp;lt;biblio&amp;gt;&lt;br /&gt;
#kim03 pmid=12668758&lt;br /&gt;
#robinson05 pmid=15998640&lt;br /&gt;
#blondeau00 pmid=11001925&lt;br /&gt;
#taylor00 pmid=10900271&lt;br /&gt;
#bujbell02 pmid=12217958&lt;br /&gt;
#kim01 pmid=11733541&lt;br /&gt;
&amp;lt;/biblio&amp;gt;&lt;/div&gt;</summary>
		<author><name>Mark</name></author>	</entry>

	<entry>
		<id>http://www.phosphatome.net/wiki/index.php/Phosphatase_Subfamily_MTMR1</id>
		<title>Phosphatase Subfamily MTMR1</title>
		<link rel="alternate" type="text/html" href="http://www.phosphatome.net/wiki/index.php/Phosphatase_Subfamily_MTMR1"/>
				<updated>2016-09-07T16:07:15Z</updated>
		
		<summary type="html">&lt;p&gt;Mark: /* Domain Structure */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;__NOTOC__&lt;br /&gt;
&lt;br /&gt;
[[Phosphatase classification|Phosphatase Classification]]: [[Phosphatase_Fold_CC1|Fold CC1]]: [[Phosphatase_Superfamily_CC1|Superfamily CC1]]:  [[Phosphatase_Family_Myotubularin|Family Myotubularin]]: [[Phosphatase_Subfamily_MTMR1|Subfamily MTMR1]]&lt;br /&gt;
&lt;br /&gt;
MTMR1 is a lipid phosphatase that dephosphorylates the second messenger phosphatidylinositol 3-monophosphate [PI(3)P].&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
MTMR1 is found throughout holozoa. It consists of three members in human, MTM1, MTMR1 and MTMR2. In fruit fly and C elegans, a single copy is found. In most vertebrates from fish to human, MTM1 and MTMR1 are adjacent on the X chromosome (see [http://www.genomicus.biologie.ens.fr/genomicus-78.01/cgi-bin/phyloview.pl?root=2198950&amp;amp;amp;id=2199015&amp;amp;amp;xhide=108:107:105:110:69:96:97:63:111:-2198950:94:92:82:115:76:46:48:57:56:67:112:78:61:3:99:52:24:81:58:10:55:83&amp;amp;amp;xcollapse=-2198950&amp;amp;amp; Genomicus]).&lt;br /&gt;
&lt;br /&gt;
===Domain Structure===&lt;br /&gt;
MTMR1 has a [http://pfam.xfam.org/family/PF02893.15 GRAM] domain, phosphatase domain and coiled-coil region. The GRAM domain is similar to the PH domain in structure and is found in membrane-associated proteins. As shown in [[Phosphatase_Subfamily_MTMR3|MTMR3 subfamily]], the GRAM domain can bind to phosphoinositide lipids. The coiled-coil domain has been shown to mediate the interaction between [[Phosphatase_Gene_MTMR2|MTMR2]] and the [[Phosphatase_Subfamily_MTMR5|MTMR5 subfamily]] members MTMR13 and MTMR5 in human &amp;lt;cite&amp;gt;kim03, robinson05&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Catalytic activity and functions===&lt;br /&gt;
Human MTM1 has phosphatase activity towards the second messenger phosphatidylinositol 3-monophosphate [PI(3)P] in vitro and in human, budding yeast, and fission yeast &amp;lt;cite&amp;gt;taylor00, blondeau00&amp;lt;/cite&amp;gt;.&lt;br /&gt;
Human MTMR1 and MTMR2 have been shown to dephosphorylate PI(3)P (&amp;lt;cite&amp;gt;bujbello02&amp;lt;/cite&amp;gt; and &amp;lt;cite&amp;gt;kim01&amp;lt;/cite&amp;gt;, respectively). Although the enzymatic properties of the three human phosphatases are indistinguishable, their functions are not totally redundant. MTM1 and MTMR2 are differentially regulated in the aspects of developmental expression and subcellular localization, resulting in their use of specific cellular pools of PI(3)P &amp;lt;cite&amp;gt;kim01&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Related Kinases===&lt;br /&gt;
See [http://en.wikipedia.org/wiki/Phosphoinositide_3-kinase PI3K].&lt;br /&gt;
&lt;br /&gt;
===References===&lt;br /&gt;
&amp;lt;biblio&amp;gt;&lt;br /&gt;
#kim03 pmid=12668758&lt;br /&gt;
#robinson05 pmid=15998640&lt;br /&gt;
#blondeau00 pmid=11001925&lt;br /&gt;
#taylor00 pmid=10900271&lt;br /&gt;
#bujbell02 pmid=12217958&lt;br /&gt;
#kim01 pmid=11733541&lt;br /&gt;
&amp;lt;/biblio&amp;gt;&lt;/div&gt;</summary>
		<author><name>Mark</name></author>	</entry>

	<entry>
		<id>http://www.phosphatome.net/wiki/index.php/Phosphatase_Subfamily_MTMR9</id>
		<title>Phosphatase Subfamily MTMR9</title>
		<link rel="alternate" type="text/html" href="http://www.phosphatome.net/wiki/index.php/Phosphatase_Subfamily_MTMR9"/>
				<updated>2016-09-07T16:05:48Z</updated>
		
		<summary type="html">&lt;p&gt;Mark: /* Domain Structure */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;__NOTOC__&lt;br /&gt;
&lt;br /&gt;
[[Phosphatase classification|Phosphatase Classification]]: [[Phosphatase_Fold_CC1|Fold CC1]]: [[Phosphatase_Superfamily_CC1|Superfamily CC1]]:  [[Phosphatase_Family_Myotubularin|Family Myotubularin]]: [[Phosphatase_Subfamily_MTMR9|Subfamily MTMR9]]&lt;br /&gt;
&lt;br /&gt;
MTMR9 is a conserved pseudophosphatase across holozoan. It regulates active phosphatases of subfamily MTMR6.&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
MTMR9 is found throughout holozoan. It is usually single copy per genome.&lt;br /&gt;
&lt;br /&gt;
===Domain Structure===&lt;br /&gt;
MTMR9 subfamily has three domains: [http://pfam.xfam.org/family/PF02893.15 PH/GRAM], phosphatase domain and coiled-coil domain. The GRAM domain is similar to PH domain in structure and is found in membrane-associated proteins. As shown in [[Phosphatase_Subfamily_MTMR3|MTMR3 subfamily]], PH/GRAM domain can bind to phosphoinositide lipids. Coiled-coil domain has been shown to mediate the interaction between MTMR9 and members of [[Phosphatase_Subfamily_MTMR6|MTMR6]] in human &amp;lt;cite&amp;gt;Mochizuki03, zou09, zou12&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Catalytic activity and functions===&lt;br /&gt;
MTMR9 is an inactive phosphatase (pseudophosphatase). MTMR9 binds to phosphatases of MTMR6 subfamily: MTMR6 &amp;lt;cite&amp;gt;zou09&amp;lt;/cite&amp;gt;, MTMR7 &amp;lt;cite&amp;gt;Mochizuki03&amp;lt;/cite&amp;gt;, MTMR8 &amp;lt;cite&amp;gt;zou12&amp;lt;/cite&amp;gt;. The interactions increase the enzymatic activity of these phosphatases. The interaction between MTMR9 and members of MTMR6 subfamily is also observed in ''C. elegans'' &amp;lt;cite&amp;gt;marie10&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===References===&lt;br /&gt;
&amp;lt;biblio&amp;gt;&lt;br /&gt;
#Mochizuki03 pmid=12890864&lt;br /&gt;
#zou09 pmid=19038970&lt;br /&gt;
#zou12 pmid=22647598&lt;br /&gt;
#marie10 pmid=21076391&lt;br /&gt;
&amp;lt;/biblio&amp;gt;&lt;/div&gt;</summary>
		<author><name>Mark</name></author>	</entry>

	<entry>
		<id>http://www.phosphatome.net/wiki/index.php/Phosphatase_Subfamily_STS</id>
		<title>Phosphatase Subfamily STS</title>
		<link rel="alternate" type="text/html" href="http://www.phosphatome.net/wiki/index.php/Phosphatase_Subfamily_STS"/>
				<updated>2016-08-31T20:06:14Z</updated>
		
		<summary type="html">&lt;p&gt;Mark: /* References */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;__NOTOC__&lt;br /&gt;
[[Phosphatase classification|Phosphatase Classification]]: [[Phosphatase_Fold_HP|Fold HP]]: [[Phosphatase_Superfamily_HP|Superfamily HP]] (histidine phosphatase):  [[Phosphatase_Family_HP1|HP, branch1 family]]: [[Phosphatase_Subfamily_STS|Subfamily STS]]&lt;br /&gt;
&lt;br /&gt;
STS is protein tyrosine phosphatase involved in T-cell receptor signaling. In particular, STS dephosphorylates kinases Syk and ZAP-70 of Syk subfamily. STS is conserved in metazoan.&lt;br /&gt;
&lt;br /&gt;
=== Evolution ===&lt;br /&gt;
STS is found in most [[Phosphatase_Glossary#metazoa|metazoa]]. Human has two STS: STS1 (TULA-2 or UBASH3B) and STS2 (TULA-1 or UBASH3A). STS1 is found in all vertebrates, while STS2 is not found in bony fish. ''C. elegans'' has five STS genes, but all of them lack UBA (ubiquitin-associated domain), 2H phosphoesterase, and SH3 domains. Interestingly, STS substrates, Syk and ZAP-70, both of which belong to SYK kinase family, are absent from ''C. elegans''.&lt;br /&gt;
&lt;br /&gt;
=== Domain ===&lt;br /&gt;
Most STS have four domains: [[Phosphatase_Glossary#Domain_UBA|UBA]]  (ubiquitin-associated domain), 2H phosphoesterase &amp;lt;cite&amp;gt;mazumder02&amp;lt;/cite&amp;gt;, [[Phosphatase_Glossary#Domain_SH3|SH3]] and HP2 phosphatase domain. The UBA, 2H and SH3 domains are absent from all nematode members (see technical notes).&lt;br /&gt;
&lt;br /&gt;
=== Functions ===&lt;br /&gt;
Human STS1 and STS2 bind to the Cbl protein via their SH3 domains and interact with several membrane-associated signaling proteins  &amp;lt;cite&amp;gt;STS_2&amp;lt;/cite&amp;gt;. In particular, STS regulates T Cell Receptor (TCR) signaling by acting on the [http://kinase.com/wiki/index.php/Kinase_Family_Syk Syk family] kinases, Syk and ZAP-70. STS2 is predominantly in naive and mature T cells (white blood, spleen and small intestine, according to [http://www.gtexportal.org/home/gene/UBASH3A GTEx]), whereas STS1 is expressed ubiquitously (according to [http://www.gtexportal.org/home/gene/UBASH3B GTEx], particularly abundant in cerebellum).&lt;br /&gt;
&lt;br /&gt;
STS1 decreases tyrosine phosphorylation of Syk ''in vivo'' and ''in vitro'' &amp;lt;cite&amp;gt;chen10, carpino04&amp;lt;/cite&amp;gt;, and this is reversed by transfection of an inactive STS1 mutant. In addition, both STS1 and STS2 regulate kinase ZAP-70 activation &amp;lt;cite&amp;gt;carpino04&amp;lt;/cite&amp;gt;. &lt;br /&gt;
&lt;br /&gt;
Human STS1 can also dephosphorylate pTyr on EGFR &amp;lt;cite&amp;gt;STS_1&amp;lt;/cite&amp;gt; and is overexpressed in triple-negative breast cancer and promotes invasion and metastasis &amp;lt;cite&amp;gt;Lee13&amp;lt;/cite&amp;gt;. STS1 dephosphorylated the EGFR at multiple tyrosines, terminating its signalling and endocytosis &amp;lt;cite&amp;gt;STS_1&amp;lt;/cite&amp;gt;. STS1 and STS2 also dephosphorylate the receptor tyrosine kinases Kit and Flt3, and double knockout mice show greatly expanded hematopoiesis &amp;lt;cite&amp;gt;Zhang&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
Drosophila STS (CG13604) was shown to have activity on phosphorylated ecdysteroids, the storage form of these molting hormones, and the C. elegans homolog T07F12.1 also had activity &amp;lt;cite&amp;gt;&amp;lt;Davies&amp;lt;/cite&amp;gt;. A silkworm homolog was also shown to have ecdysteroid phosphatase activity &amp;lt;cite&amp;gt;Yamada&amp;lt;/cite&amp;gt;. An Unclassified HP1-family yeast phosphatase, [http://phosphatome.net/3.0/database/gene/uid/ScerP017 DET1] has been implicated in sterol trafficking &amp;lt;cite&amp;gt;Sullivan&amp;lt;/cite&amp;gt;, but it is not known if phosphatase activity is involved.&lt;br /&gt;
&lt;br /&gt;
=== Technical notes ===&lt;br /&gt;
===== Nematodes lost UBA, 2H and SH3 domain =====&lt;br /&gt;
Loss of UBA, 2H and SH3 domain was seen in all C. elegans STS. NCBI Blast, interrogation of an internal orthology database, and Pfam profiling were used to show that all other nematode STS proteins also lack these domains.&lt;br /&gt;
&lt;br /&gt;
===References===&lt;br /&gt;
&amp;lt;biblio&amp;gt;&lt;br /&gt;
#Davies pmid=17348005&lt;br /&gt;
#STS_1 pmid=17880946&lt;br /&gt;
#STS_2 pmid=18189269&lt;br /&gt;
#carpino04 pmid=14738763&lt;br /&gt;
#chen10 pmid=20670933&lt;br /&gt;
#Lee13 pmid=23784775&lt;br /&gt;
#mazumder02 pmid=12466548&lt;br /&gt;
#Sullivan pmid=19060182&lt;br /&gt;
#Yamada pmid=12721294&lt;br /&gt;
#Zhang pmid=26365512&lt;br /&gt;
&amp;lt;/biblio&amp;gt;&lt;/div&gt;</summary>
		<author><name>Mark</name></author>	</entry>

	<entry>
		<id>http://www.phosphatome.net/wiki/index.php/CTD_Phosphorylation</id>
		<title>CTD Phosphorylation</title>
		<link rel="alternate" type="text/html" href="http://www.phosphatome.net/wiki/index.php/CTD_Phosphorylation"/>
				<updated>2016-05-15T00:12:18Z</updated>
		
		<summary type="html">&lt;p&gt;Mark: /* Phosphatases */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;[[Main_Page|Main Page]]:[[CTD_Phosphorylation|CTD Phosphorylation]]&lt;br /&gt;
&lt;br /&gt;
== Introduction ==&lt;br /&gt;
The C-terminal domain (CTD) of RNA polymerase II's largest subunit undergoes patterned dynamic phosphorylation during the transcription cycle. Each phosphorylation pattern recruits a particular set of mRNA-processing and histone-modifying factors. The CTD contains many copies of a heptapeptide repeat with 5 phosphorylation sites in the consensus sequence (Y1, S2, T4, S5, S7). ''In vivo'' phosphorylation occurs mainly on serine residues. This complex phosphorylation pattern is regulated by several phosphatases and kinases &amp;lt;cite&amp;gt;Buratowski&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
== Phosphatases == &lt;br /&gt;
{| border=&amp;quot;1&amp;quot; cellpadding=&amp;quot;5&amp;quot; cellspacing=&amp;quot;0&amp;quot; align=&amp;quot;center&amp;quot;&amp;quot;&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Mammals&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Yeast&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Group&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Family&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Subfamily&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Substrate&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Stage&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Evolution (from yeast to human)&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Note&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | FCP1&lt;br /&gt;
| FCP1 || HAD || FCP || [[Phosphatase_Subfamily_FCP1|FCP1]] || pSer2, pThr4 &amp;lt;cite&amp;gt;hsin2014&amp;lt;/cite&amp;gt; || To Recycling || From yeast to human || &lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | SCP1, SCP2, SCP3&lt;br /&gt;
| SCP || HAD || FCP || [[Phosphatase_Subfamily_SCP|SCP]] || pSer5 || To cleavage, polyA and termination || From yeast to human || The function toward pSer5 of one of its member, SCP1, has been verified in mammals, but not in yeast, yet.&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | SSU72&lt;br /&gt;
| SSU72 || CC2|| [[Phosphatase_Family_SSU72|SSU72]] || SSU72 || pSer5 || To cleavage, polyA and termination || From yeast to human ||  1) Its function toward pSer5 has been verified in yeast, but not mammals. 2) Unlike other phosphatases, it has a fold similar to LMWPTP rather than HAD.&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | CTDSPL2&lt;br /&gt;
| N/A || HAD || FCP || [[Phosphatase_Subfamily_CTDSPL2|CTDSPL2]] || ? || ? || From Monosiga to human but lost in fly || 1) In vitro activity toward CTD.&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | UBLCP1&lt;br /&gt;
| N/A || HAD || FCP || [[Phosphatase_Subfamily_UBLCP1|UBLCP1]] || ? || ? || From anemone to human but lost in nematode || 1) In vitro activity toward CTD. &lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | RPAP2&lt;br /&gt;
| RTR1, RTR2 || RTR1 || RTR1 || [[Phosphatase_Subfamily_RTR1|RTR1]] || pSer5, pTyr1 || ? || RTR1 is found in most of eukaryotes. It is absent from Monosiga and sponge genome || &lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | ?&lt;br /&gt;
| N/A || ? || ? || ? || pSer7 || ? || ? || Observed phosphorylated pSer7, but the phosphatase and kinase are unknown.&lt;br /&gt;
|}&lt;br /&gt;
&lt;br /&gt;
== Kinases ==&lt;br /&gt;
{| border=&amp;quot;1&amp;quot; cellpadding=&amp;quot;5&amp;quot; cellspacing=&amp;quot;0&amp;quot; align=&amp;quot;center&amp;quot;&amp;quot;&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Mammals&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Yeast&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Group&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Family&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Subfamily&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Substrate&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Stage&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Evolution&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Note&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | CDK7&lt;br /&gt;
| KIN28 || CMGC || CDK || CDK7 || Ser5, Ser7 || To initiation || From yeast to human but lost in Monosiga? || 1) CDK7 is a component of transcription factor TFIIH. 2) KinBase shows it is absent from Monosiga. &lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | CDK9&lt;br /&gt;
| Bur1 || CMGC || CDK || CDK9 || Ser2, Ser7 || To elongation || From yeast to human but lost in Monosiga? || 1) CDK9 is the catalytic subunit of the positive transcription elongation factor (P-TEF)b complex. 2) KinBase shows it is absent from Monosiga.&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | CRK7&lt;br /&gt;
| CTK1 || CMGC || CDK || CRK7 || Ser2 || To elongation || From Giardia to human but lost in Tetrahymena || It has been verified in yeast, but not in mammals.&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | CDK8&lt;br /&gt;
| CDK8 ||  CMGC || CDK || CDK8 || Ser2 and Ser5 || In the pool of pol II? || From yeast to human || &lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | CDC2&lt;br /&gt;
| CDK1 ||  CMGC || CDK || CDC2 || Ser2 and Ser5 || In the pool of pol II? || From Giardia to human || In KInbase, conserved in yeast in the tree, but absent in the hits.&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | ERK1/2&lt;br /&gt;
| FUS3, KSS1, SLT2, SMK1, YKL161C ||  CMGC || MAPK || ERK1 || Ser5 || In the pool of pol II? || From Monosiga to human || Many yeast proteins in this subfamily of extracellular signal-related kinase 1/2 (ERK1 in KinBase).&lt;br /&gt;
|}&lt;br /&gt;
&lt;br /&gt;
== References==&lt;br /&gt;
&lt;br /&gt;
&amp;lt;biblio&amp;gt;&lt;br /&gt;
#Buratowski pmid=19941815&lt;br /&gt;
#Akhtar pmid=19450536&lt;br /&gt;
#Tietjen pmid=20802488&lt;br /&gt;
#Kim pmid=20835241 &lt;br /&gt;
#Yang pmid=15744326&lt;br /&gt;
#Chapman pmid=18472177&lt;br /&gt;
#Stiller pmid=11972039&lt;br /&gt;
#Egloff  pmid=18457900&lt;br /&gt;
#hsin2014 pmid=24752900&lt;br /&gt;
&amp;lt;/biblio&amp;gt;&lt;/div&gt;</summary>
		<author><name>Mark</name></author>	</entry>

	<entry>
		<id>http://www.phosphatome.net/wiki/index.php/CTD_Phosphorylation</id>
		<title>CTD Phosphorylation</title>
		<link rel="alternate" type="text/html" href="http://www.phosphatome.net/wiki/index.php/CTD_Phosphorylation"/>
				<updated>2016-05-15T00:12:01Z</updated>
		
		<summary type="html">&lt;p&gt;Mark: /* Phosphatases */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;[[Main_Page|Main Page]]:[[CTD_Phosphorylation|CTD Phosphorylation]]&lt;br /&gt;
&lt;br /&gt;
== Introduction ==&lt;br /&gt;
The C-terminal domain (CTD) of RNA polymerase II's largest subunit undergoes patterned dynamic phosphorylation during the transcription cycle. Each phosphorylation pattern recruits a particular set of mRNA-processing and histone-modifying factors. The CTD contains many copies of a heptapeptide repeat with 5 phosphorylation sites in the consensus sequence (Y1, S2, T4, S5, S7). ''In vivo'' phosphorylation occurs mainly on serine residues. This complex phosphorylation pattern is regulated by several phosphatases and kinases &amp;lt;cite&amp;gt;Buratowski&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
== Phosphatases == &lt;br /&gt;
{| border=&amp;quot;1&amp;quot; cellpadding=&amp;quot;5&amp;quot; cellspacing=&amp;quot;0&amp;quot; align=&amp;quot;center&amp;quot;&amp;quot;&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Mammals&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Yeast&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Group&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Family&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Subfamily&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Substrate&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Stage&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Evolution (from yeast to human)&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Note&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | [[FCP1]] &lt;br /&gt;
| FCP1 || HAD || FCP || [[Phosphatase_Subfamily_FCP1|FCP1]] || pSer2, pThr4 &amp;lt;cite&amp;gt;hsin2014&amp;lt;/cite&amp;gt; || To Recycling || From yeast to human || &lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | SCP1, SCP2, SCP3&lt;br /&gt;
| SCP || HAD || FCP || [[Phosphatase_Subfamily_SCP|SCP]] || pSer5 || To cleavage, polyA and termination || From yeast to human || The function toward pSer5 of one of its member, SCP1, has been verified in mammals, but not in yeast, yet.&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | SSU72&lt;br /&gt;
| SSU72 || CC2|| [[Phosphatase_Family_SSU72|SSU72]] || SSU72 || pSer5 || To cleavage, polyA and termination || From yeast to human ||  1) Its function toward pSer5 has been verified in yeast, but not mammals. 2) Unlike other phosphatases, it has a fold similar to LMWPTP rather than HAD.&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | CTDSPL2&lt;br /&gt;
| N/A || HAD || FCP || [[Phosphatase_Subfamily_CTDSPL2|CTDSPL2]] || ? || ? || From Monosiga to human but lost in fly || 1) In vitro activity toward CTD.&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | UBLCP1&lt;br /&gt;
| N/A || HAD || FCP || [[Phosphatase_Subfamily_UBLCP1|UBLCP1]] || ? || ? || From anemone to human but lost in nematode || 1) In vitro activity toward CTD. &lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | RPAP2&lt;br /&gt;
| RTR1, RTR2 || RTR1 || RTR1 || [[Phosphatase_Subfamily_RTR1|RTR1]] || pSer5, pTyr1 || ? || RTR1 is found in most of eukaryotes. It is absent from Monosiga and sponge genome || &lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | ?&lt;br /&gt;
| N/A || ? || ? || ? || pSer7 || ? || ? || Observed phosphorylated pSer7, but the phosphatase and kinase are unknown.&lt;br /&gt;
|}&lt;br /&gt;
&lt;br /&gt;
== Kinases ==&lt;br /&gt;
{| border=&amp;quot;1&amp;quot; cellpadding=&amp;quot;5&amp;quot; cellspacing=&amp;quot;0&amp;quot; align=&amp;quot;center&amp;quot;&amp;quot;&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Mammals&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Yeast&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Group&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Family&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Subfamily&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Substrate&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Stage&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Evolution&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Note&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | CDK7&lt;br /&gt;
| KIN28 || CMGC || CDK || CDK7 || Ser5, Ser7 || To initiation || From yeast to human but lost in Monosiga? || 1) CDK7 is a component of transcription factor TFIIH. 2) KinBase shows it is absent from Monosiga. &lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | CDK9&lt;br /&gt;
| Bur1 || CMGC || CDK || CDK9 || Ser2, Ser7 || To elongation || From yeast to human but lost in Monosiga? || 1) CDK9 is the catalytic subunit of the positive transcription elongation factor (P-TEF)b complex. 2) KinBase shows it is absent from Monosiga.&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | CRK7&lt;br /&gt;
| CTK1 || CMGC || CDK || CRK7 || Ser2 || To elongation || From Giardia to human but lost in Tetrahymena || It has been verified in yeast, but not in mammals.&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | CDK8&lt;br /&gt;
| CDK8 ||  CMGC || CDK || CDK8 || Ser2 and Ser5 || In the pool of pol II? || From yeast to human || &lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | CDC2&lt;br /&gt;
| CDK1 ||  CMGC || CDK || CDC2 || Ser2 and Ser5 || In the pool of pol II? || From Giardia to human || In KInbase, conserved in yeast in the tree, but absent in the hits.&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | ERK1/2&lt;br /&gt;
| FUS3, KSS1, SLT2, SMK1, YKL161C ||  CMGC || MAPK || ERK1 || Ser5 || In the pool of pol II? || From Monosiga to human || Many yeast proteins in this subfamily of extracellular signal-related kinase 1/2 (ERK1 in KinBase).&lt;br /&gt;
|}&lt;br /&gt;
&lt;br /&gt;
== References==&lt;br /&gt;
&lt;br /&gt;
&amp;lt;biblio&amp;gt;&lt;br /&gt;
#Buratowski pmid=19941815&lt;br /&gt;
#Akhtar pmid=19450536&lt;br /&gt;
#Tietjen pmid=20802488&lt;br /&gt;
#Kim pmid=20835241 &lt;br /&gt;
#Yang pmid=15744326&lt;br /&gt;
#Chapman pmid=18472177&lt;br /&gt;
#Stiller pmid=11972039&lt;br /&gt;
#Egloff  pmid=18457900&lt;br /&gt;
#hsin2014 pmid=24752900&lt;br /&gt;
&amp;lt;/biblio&amp;gt;&lt;/div&gt;</summary>
		<author><name>Mark</name></author>	</entry>

	<entry>
		<id>http://www.phosphatome.net/wiki/index.php/CTD_Phosphorylation</id>
		<title>CTD Phosphorylation</title>
		<link rel="alternate" type="text/html" href="http://www.phosphatome.net/wiki/index.php/CTD_Phosphorylation"/>
				<updated>2016-05-15T00:10:08Z</updated>
		
		<summary type="html">&lt;p&gt;Mark: /* Phosphatases */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;[[Main_Page|Main Page]]:[[CTD_Phosphorylation|CTD Phosphorylation]]&lt;br /&gt;
&lt;br /&gt;
== Introduction ==&lt;br /&gt;
The C-terminal domain (CTD) of RNA polymerase II's largest subunit undergoes patterned dynamic phosphorylation during the transcription cycle. Each phosphorylation pattern recruits a particular set of mRNA-processing and histone-modifying factors. The CTD contains many copies of a heptapeptide repeat with 5 phosphorylation sites in the consensus sequence (Y1, S2, T4, S5, S7). ''In vivo'' phosphorylation occurs mainly on serine residues. This complex phosphorylation pattern is regulated by several phosphatases and kinases &amp;lt;cite&amp;gt;Buratowski&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
== Phosphatases == &lt;br /&gt;
{| border=&amp;quot;1&amp;quot; cellpadding=&amp;quot;5&amp;quot; cellspacing=&amp;quot;0&amp;quot; align=&amp;quot;center&amp;quot;&amp;quot;&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Mammals&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Yeast&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Group&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Family&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Subfamily&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Substrate&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Stage&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Evolution (from yeast to human)&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Note&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | [[FCP1]] &lt;br /&gt;
| FCP1 || HAD || FCP || [[Phosphatase_Subfamily_FCP1|FCP1]] || pSer2, pThr4 &amp;lt;cite&amp;gt;hsin2014&amp;lt;/cite&amp;gt; || To Recycling || From yeast to human || &lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | SCP1, SCP2, SCP3&lt;br /&gt;
| SCP || HAD || FCP || [[Phosphatase_Subfamily_SCP|SCP]] || pSer5 || To cleavage, polyA and termination || From yeast to human || The function toward pSer5 of one of its member, SCP1, has been verified in mammals, but not in yeast, yet.&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | SSU72&lt;br /&gt;
| SSU72 || CC2|| SSU72 || [[Phosphatase_Subfamily_SSU72|SSU72]] || pSer5 || To cleavage, polyA and termination || From yeast to human ||  1) Its function toward pSer5 has been verified in yeast, but not mammals. 2) Unlike other phosphatases, it has a fold similar to LMWPTP rather than HAD.&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | CTDSPL2&lt;br /&gt;
| N/A || HAD || FCP || [[Phosphatase_Subfamily_CTDSPL2|CTDSPL2]] || ? || ? || From Monosiga to human but lost in fly || 1) In vitro activity toward CTD.&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | UBLCP1&lt;br /&gt;
| N/A || HAD || FCP || [[Phosphatase_Subfamily_UBLCP1|UBLCP1]] || ? || ? || From anemone to human but lost in nematode || 1) In vitro activity toward CTD. &lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | RPAP2&lt;br /&gt;
| RTR1, RTR2 || RTR1 || RTR1 || [[Phosphatase_Subfamily_RTR1|RTR1]] || pSer5, pTyr1 || ? || RTR1 is found in most of eukaryotes. It is absent from Monosiga and sponge genome || &lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | ?&lt;br /&gt;
| N/A || ? || ? || ? || pSer7 || ? || ? || Observed phosphorylated pSer7, but the phosphatase and kinase are unknown.&lt;br /&gt;
|}&lt;br /&gt;
&lt;br /&gt;
== Kinases ==&lt;br /&gt;
{| border=&amp;quot;1&amp;quot; cellpadding=&amp;quot;5&amp;quot; cellspacing=&amp;quot;0&amp;quot; align=&amp;quot;center&amp;quot;&amp;quot;&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Mammals&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Yeast&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Group&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Family&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Subfamily&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Substrate&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Stage&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Evolution&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Note&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | CDK7&lt;br /&gt;
| KIN28 || CMGC || CDK || CDK7 || Ser5, Ser7 || To initiation || From yeast to human but lost in Monosiga? || 1) CDK7 is a component of transcription factor TFIIH. 2) KinBase shows it is absent from Monosiga. &lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | CDK9&lt;br /&gt;
| Bur1 || CMGC || CDK || CDK9 || Ser2, Ser7 || To elongation || From yeast to human but lost in Monosiga? || 1) CDK9 is the catalytic subunit of the positive transcription elongation factor (P-TEF)b complex. 2) KinBase shows it is absent from Monosiga.&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | CRK7&lt;br /&gt;
| CTK1 || CMGC || CDK || CRK7 || Ser2 || To elongation || From Giardia to human but lost in Tetrahymena || It has been verified in yeast, but not in mammals.&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | CDK8&lt;br /&gt;
| CDK8 ||  CMGC || CDK || CDK8 || Ser2 and Ser5 || In the pool of pol II? || From yeast to human || &lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | CDC2&lt;br /&gt;
| CDK1 ||  CMGC || CDK || CDC2 || Ser2 and Ser5 || In the pool of pol II? || From Giardia to human || In KInbase, conserved in yeast in the tree, but absent in the hits.&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | ERK1/2&lt;br /&gt;
| FUS3, KSS1, SLT2, SMK1, YKL161C ||  CMGC || MAPK || ERK1 || Ser5 || In the pool of pol II? || From Monosiga to human || Many yeast proteins in this subfamily of extracellular signal-related kinase 1/2 (ERK1 in KinBase).&lt;br /&gt;
|}&lt;br /&gt;
&lt;br /&gt;
== References==&lt;br /&gt;
&lt;br /&gt;
&amp;lt;biblio&amp;gt;&lt;br /&gt;
#Buratowski pmid=19941815&lt;br /&gt;
#Akhtar pmid=19450536&lt;br /&gt;
#Tietjen pmid=20802488&lt;br /&gt;
#Kim pmid=20835241 &lt;br /&gt;
#Yang pmid=15744326&lt;br /&gt;
#Chapman pmid=18472177&lt;br /&gt;
#Stiller pmid=11972039&lt;br /&gt;
#Egloff  pmid=18457900&lt;br /&gt;
#hsin2014 pmid=24752900&lt;br /&gt;
&amp;lt;/biblio&amp;gt;&lt;/div&gt;</summary>
		<author><name>Mark</name></author>	</entry>

	<entry>
		<id>http://www.phosphatome.net/wiki/index.php/CTD_Phosphorylation</id>
		<title>CTD Phosphorylation</title>
		<link rel="alternate" type="text/html" href="http://www.phosphatome.net/wiki/index.php/CTD_Phosphorylation"/>
				<updated>2016-05-15T00:09:20Z</updated>
		
		<summary type="html">&lt;p&gt;Mark: /* Phosphatases */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;[[Main_Page|Main Page]]:[[CTD_Phosphorylation|CTD Phosphorylation]]&lt;br /&gt;
&lt;br /&gt;
== Introduction ==&lt;br /&gt;
The C-terminal domain (CTD) of RNA polymerase II's largest subunit undergoes patterned dynamic phosphorylation during the transcription cycle. Each phosphorylation pattern recruits a particular set of mRNA-processing and histone-modifying factors. The CTD contains many copies of a heptapeptide repeat with 5 phosphorylation sites in the consensus sequence (Y1, S2, T4, S5, S7). ''In vivo'' phosphorylation occurs mainly on serine residues. This complex phosphorylation pattern is regulated by several phosphatases and kinases &amp;lt;cite&amp;gt;Buratowski&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
== Phosphatases == &lt;br /&gt;
{| border=&amp;quot;1&amp;quot; cellpadding=&amp;quot;5&amp;quot; cellspacing=&amp;quot;0&amp;quot; align=&amp;quot;center&amp;quot;&amp;quot;&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Mammals&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Yeast&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Group&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Family&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Subfamily&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Substrate&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Stage&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Evolution (from yeast to human)&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Note&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | [[FCP1]] &lt;br /&gt;
| FCP1 || HAD || FCP || [[Phosphatase_Subfamily_FCP1|FCP1]] || pSer2, pThr4 &amp;lt;cite&amp;gt;hsin2014&amp;lt;/cite&amp;gt; || To Recycling || From yeast to human || &lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | SCP1, SCP2, SCP3&lt;br /&gt;
| SCP || HAD || FCP || [[Phosphatase_Subfamily_SCP|SCP]] || pSer5 || To cleavage, polyA and termination || From yeast to human || The function toward pSer5 of one of its member, SCP1, has been verified in mammals, but not in yeast, yet.&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | SSU72&lt;br /&gt;
| SSU72 || CC2|| SSU72 || [[Phosphatase_Subfamily_SSU72|SSU72]] || pSer5 || To cleavage, polyA and termination || From yeast to human ||  1) Its function toward pSer5 has been verified in yeast, but not mammals. 2) Unlike other phosphatases, it has a fold similar to LMWPTP rather than HAD.&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | CTDSPL2&lt;br /&gt;
| N/A || HAD || FCP || [[Phosphatase_Subfamily_CTDSPL2|CTDSPL2]] || ? || ? || From Monosiga to human but lost in fly || 1) In vitro activity toward CTD. 2) HSPC129 was divergent from SCP family.&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | UBLCP1&lt;br /&gt;
| N/A || HAD || FCP || [[Phosphatase_Subfamily_UBLCP1|UBLCP1]] || ? || ? || From anemone to human but lost in nematode || 1) In vitro activity toward CTD. &lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | RPAP2&lt;br /&gt;
| RTR1, RTR2 || RTR1 || RTR1 || [[Phosphatase_Subfamily_RTR1|RTR1]] || pSer5, pTyr1 || ? || RTR1 is found in most of eukaryotes. It is absent from Monosiga and sponge genome || &lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | ?&lt;br /&gt;
| N/A || ? || ? || ? || pSer7 || ? || ? || Observed phosphorylated pSer7, but the phosphatase and kinase are unknown.&lt;br /&gt;
|}&lt;br /&gt;
&lt;br /&gt;
== Kinases ==&lt;br /&gt;
{| border=&amp;quot;1&amp;quot; cellpadding=&amp;quot;5&amp;quot; cellspacing=&amp;quot;0&amp;quot; align=&amp;quot;center&amp;quot;&amp;quot;&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Mammals&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Yeast&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Group&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Family&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Subfamily&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Substrate&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Stage&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Evolution&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Note&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | CDK7&lt;br /&gt;
| KIN28 || CMGC || CDK || CDK7 || Ser5, Ser7 || To initiation || From yeast to human but lost in Monosiga? || 1) CDK7 is a component of transcription factor TFIIH. 2) KinBase shows it is absent from Monosiga. &lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | CDK9&lt;br /&gt;
| Bur1 || CMGC || CDK || CDK9 || Ser2, Ser7 || To elongation || From yeast to human but lost in Monosiga? || 1) CDK9 is the catalytic subunit of the positive transcription elongation factor (P-TEF)b complex. 2) KinBase shows it is absent from Monosiga.&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | CRK7&lt;br /&gt;
| CTK1 || CMGC || CDK || CRK7 || Ser2 || To elongation || From Giardia to human but lost in Tetrahymena || It has been verified in yeast, but not in mammals.&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | CDK8&lt;br /&gt;
| CDK8 ||  CMGC || CDK || CDK8 || Ser2 and Ser5 || In the pool of pol II? || From yeast to human || &lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | CDC2&lt;br /&gt;
| CDK1 ||  CMGC || CDK || CDC2 || Ser2 and Ser5 || In the pool of pol II? || From Giardia to human || In KInbase, conserved in yeast in the tree, but absent in the hits.&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | ERK1/2&lt;br /&gt;
| FUS3, KSS1, SLT2, SMK1, YKL161C ||  CMGC || MAPK || ERK1 || Ser5 || In the pool of pol II? || From Monosiga to human || Many yeast proteins in this subfamily of extracellular signal-related kinase 1/2 (ERK1 in KinBase).&lt;br /&gt;
|}&lt;br /&gt;
&lt;br /&gt;
== References==&lt;br /&gt;
&lt;br /&gt;
&amp;lt;biblio&amp;gt;&lt;br /&gt;
#Buratowski pmid=19941815&lt;br /&gt;
#Akhtar pmid=19450536&lt;br /&gt;
#Tietjen pmid=20802488&lt;br /&gt;
#Kim pmid=20835241 &lt;br /&gt;
#Yang pmid=15744326&lt;br /&gt;
#Chapman pmid=18472177&lt;br /&gt;
#Stiller pmid=11972039&lt;br /&gt;
#Egloff  pmid=18457900&lt;br /&gt;
#hsin2014 pmid=24752900&lt;br /&gt;
&amp;lt;/biblio&amp;gt;&lt;/div&gt;</summary>
		<author><name>Mark</name></author>	</entry>

	<entry>
		<id>http://www.phosphatome.net/wiki/index.php/CTD_Phosphorylation</id>
		<title>CTD Phosphorylation</title>
		<link rel="alternate" type="text/html" href="http://www.phosphatome.net/wiki/index.php/CTD_Phosphorylation"/>
				<updated>2016-05-15T00:09:01Z</updated>
		
		<summary type="html">&lt;p&gt;Mark: /* Phosphatases */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;[[Main_Page|Main Page]]:[[CTD_Phosphorylation|CTD Phosphorylation]]&lt;br /&gt;
&lt;br /&gt;
== Introduction ==&lt;br /&gt;
The C-terminal domain (CTD) of RNA polymerase II's largest subunit undergoes patterned dynamic phosphorylation during the transcription cycle. Each phosphorylation pattern recruits a particular set of mRNA-processing and histone-modifying factors. The CTD contains many copies of a heptapeptide repeat with 5 phosphorylation sites in the consensus sequence (Y1, S2, T4, S5, S7). ''In vivo'' phosphorylation occurs mainly on serine residues. This complex phosphorylation pattern is regulated by several phosphatases and kinases &amp;lt;cite&amp;gt;Buratowski&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
== Phosphatases == &lt;br /&gt;
{| border=&amp;quot;1&amp;quot; cellpadding=&amp;quot;5&amp;quot; cellspacing=&amp;quot;0&amp;quot; align=&amp;quot;center&amp;quot;&amp;quot;&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Mammals&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Yeast&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Group&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Family&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Subfamily&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Substrate&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Stage&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Evolution (from yeast to human)&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Note&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | [[FCP1]] &lt;br /&gt;
| FCP1 || HAD || FCP || [[Phosphatase_Subfamily_FCP1|FCP1]] || pSer2, pThr4 &amp;lt;cite&amp;gt;hsin2014&amp;lt;/cite&amp;gt; || To Recycling || From yeast to human || &lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | SCP1, SCP2, SCP3&lt;br /&gt;
| SCP || HAD || FCP || || [[Phosphatase_Subfamily_SCP|SCP]] || pSer5 || To cleavage, polyA and termination || From yeast to human || The function toward pSer5 of one of its member, SCP1, has been verified in mammals, but not in yeast, yet.&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | SSU72&lt;br /&gt;
| SSU72 || CC2|| SSU72 || [[Phosphatase_Subfamily_SSU72|SSU72]] || pSer5 || To cleavage, polyA and termination || From yeast to human ||  1) Its function toward pSer5 has been verified in yeast, but not mammals. 2) Unlike other phosphatases, it has a fold similar to LMWPTP rather than HAD.&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | CTDSPL2&lt;br /&gt;
| N/A || HAD || FCP || [[Phosphatase_Subfamily_CTDSPL2|CTDSPL2]] || ? || ? || From Monosiga to human but lost in fly || 1) In vitro activity toward CTD. 2) HSPC129 was divergent from SCP family.&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | UBLCP1&lt;br /&gt;
| N/A || HAD || FCP || [[Phosphatase_Subfamily_UBLCP1|UBLCP1]] || ? || ? || From anemone to human but lost in nematode || 1) In vitro activity toward CTD. &lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | RPAP2&lt;br /&gt;
| RTR1, RTR2 || RTR1 || RTR1 || [[Phosphatase_Subfamily_RTR1|RTR1]] || pSer5, pTyr1 || ? || RTR1 is found in most of eukaryotes. It is absent from Monosiga and sponge genome || &lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | ?&lt;br /&gt;
| N/A || ? || ? || ? || pSer7 || ? || ? || Observed phosphorylated pSer7, but the phosphatase and kinase are unknown.&lt;br /&gt;
|}&lt;br /&gt;
&lt;br /&gt;
== Kinases ==&lt;br /&gt;
{| border=&amp;quot;1&amp;quot; cellpadding=&amp;quot;5&amp;quot; cellspacing=&amp;quot;0&amp;quot; align=&amp;quot;center&amp;quot;&amp;quot;&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Mammals&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Yeast&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Group&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Family&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Subfamily&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Substrate&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Stage&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Evolution&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Note&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | CDK7&lt;br /&gt;
| KIN28 || CMGC || CDK || CDK7 || Ser5, Ser7 || To initiation || From yeast to human but lost in Monosiga? || 1) CDK7 is a component of transcription factor TFIIH. 2) KinBase shows it is absent from Monosiga. &lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | CDK9&lt;br /&gt;
| Bur1 || CMGC || CDK || CDK9 || Ser2, Ser7 || To elongation || From yeast to human but lost in Monosiga? || 1) CDK9 is the catalytic subunit of the positive transcription elongation factor (P-TEF)b complex. 2) KinBase shows it is absent from Monosiga.&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | CRK7&lt;br /&gt;
| CTK1 || CMGC || CDK || CRK7 || Ser2 || To elongation || From Giardia to human but lost in Tetrahymena || It has been verified in yeast, but not in mammals.&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | CDK8&lt;br /&gt;
| CDK8 ||  CMGC || CDK || CDK8 || Ser2 and Ser5 || In the pool of pol II? || From yeast to human || &lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | CDC2&lt;br /&gt;
| CDK1 ||  CMGC || CDK || CDC2 || Ser2 and Ser5 || In the pool of pol II? || From Giardia to human || In KInbase, conserved in yeast in the tree, but absent in the hits.&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | ERK1/2&lt;br /&gt;
| FUS3, KSS1, SLT2, SMK1, YKL161C ||  CMGC || MAPK || ERK1 || Ser5 || In the pool of pol II? || From Monosiga to human || Many yeast proteins in this subfamily of extracellular signal-related kinase 1/2 (ERK1 in KinBase).&lt;br /&gt;
|}&lt;br /&gt;
&lt;br /&gt;
== References==&lt;br /&gt;
&lt;br /&gt;
&amp;lt;biblio&amp;gt;&lt;br /&gt;
#Buratowski pmid=19941815&lt;br /&gt;
#Akhtar pmid=19450536&lt;br /&gt;
#Tietjen pmid=20802488&lt;br /&gt;
#Kim pmid=20835241 &lt;br /&gt;
#Yang pmid=15744326&lt;br /&gt;
#Chapman pmid=18472177&lt;br /&gt;
#Stiller pmid=11972039&lt;br /&gt;
#Egloff  pmid=18457900&lt;br /&gt;
#hsin2014 pmid=24752900&lt;br /&gt;
&amp;lt;/biblio&amp;gt;&lt;/div&gt;</summary>
		<author><name>Mark</name></author>	</entry>

	<entry>
		<id>http://www.phosphatome.net/wiki/index.php/CTD_Phosphorylation</id>
		<title>CTD Phosphorylation</title>
		<link rel="alternate" type="text/html" href="http://www.phosphatome.net/wiki/index.php/CTD_Phosphorylation"/>
				<updated>2016-05-15T00:03:56Z</updated>
		
		<summary type="html">&lt;p&gt;Mark: /* Phosphatases */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;[[Main_Page|Main Page]]:[[CTD_Phosphorylation|CTD Phosphorylation]]&lt;br /&gt;
&lt;br /&gt;
== Introduction ==&lt;br /&gt;
The C-terminal domain (CTD) of RNA polymerase II's largest subunit undergoes patterned dynamic phosphorylation during the transcription cycle. Each phosphorylation pattern recruits a particular set of mRNA-processing and histone-modifying factors. The CTD contains many copies of a heptapeptide repeat with 5 phosphorylation sites in the consensus sequence (Y1, S2, T4, S5, S7). ''In vivo'' phosphorylation occurs mainly on serine residues. This complex phosphorylation pattern is regulated by several phosphatases and kinases &amp;lt;cite&amp;gt;Buratowski&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
== Phosphatases == &lt;br /&gt;
{| border=&amp;quot;1&amp;quot; cellpadding=&amp;quot;5&amp;quot; cellspacing=&amp;quot;0&amp;quot; align=&amp;quot;center&amp;quot;&amp;quot;&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Mammals&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Yeast&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Group&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Family&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Substrate&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Stage&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Evolution (from yeast to human)&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Note&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | [[FCP1]] &lt;br /&gt;
| FCP1 || HAD || FCP || pSer2, pThr4 &amp;lt;cite&amp;gt;hsin2014&amp;lt;/cite&amp;gt; || To Recycling || From yeast to human || &lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | [[SCP]]&lt;br /&gt;
| SCP || HAD || FCP || pSer5 || To cleavage, polyA and termination || From yeast to human || The function toward pSer5 of one of its member, SCP1, has been verified in mammals, but not in yeast, yet.&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | [[SSU72]]&lt;br /&gt;
| SSU72 || CC2|| SSU72 || pSer5 || To cleavage, polyA and termination || From yeast to human ||  1) Its function toward pSer5 has been verified in yeast, but not mammals. 2) Unlike other phosphatases, it has a fold similar to LMWPTP rather than HAD.&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | [[HSPC129]]&lt;br /&gt;
| N/A || HAD || FCP || ? || ? || From Monosiga to human but lost in fly || 1) In vitro activity toward CTD. 2) HSPC129 was divergent from SCP family.&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | [[UBLCP1]]&lt;br /&gt;
| N/A || HAD || SCP || ? || ? || From anemone to human but lost in nematode || 1) In vitro activity toward CTD. &lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | RPAP2&lt;br /&gt;
| RTR1, RTR2 || RTR1 || RTR1 || pSer5, pTyr1 ||  || RTR1 is found in most of eukaryotes. It is absent from Monosiga and sponge genome || &lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | ?&lt;br /&gt;
| N/A || ? || ? || pSer7 || ? || ? || Observed phosphorylated pSer7, but the phosphatase and kinase are unknown.&lt;br /&gt;
|}&lt;br /&gt;
&lt;br /&gt;
== Kinases ==&lt;br /&gt;
{| border=&amp;quot;1&amp;quot; cellpadding=&amp;quot;5&amp;quot; cellspacing=&amp;quot;0&amp;quot; align=&amp;quot;center&amp;quot;&amp;quot;&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Mammals&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Yeast&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Group&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Family&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Subfamily&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Substrate&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Stage&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Evolution&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Note&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | CDK7&lt;br /&gt;
| KIN28 || CMGC || CDK || CDK7 || Ser5, Ser7 || To initiation || From yeast to human but lost in Monosiga? || 1) CDK7 is a component of transcription factor TFIIH. 2) KinBase shows it is absent from Monosiga. &lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | CDK9&lt;br /&gt;
| Bur1 || CMGC || CDK || CDK9 || Ser2, Ser7 || To elongation || From yeast to human but lost in Monosiga? || 1) CDK9 is the catalytic subunit of the positive transcription elongation factor (P-TEF)b complex. 2) KinBase shows it is absent from Monosiga.&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | CRK7&lt;br /&gt;
| CTK1 || CMGC || CDK || CRK7 || Ser2 || To elongation || From Giardia to human but lost in Tetrahymena || It has been verified in yeast, but not in mammals.&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | CDK8&lt;br /&gt;
| CDK8 ||  CMGC || CDK || CDK8 || Ser2 and Ser5 || In the pool of pol II? || From yeast to human || &lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | CDC2&lt;br /&gt;
| CDK1 ||  CMGC || CDK || CDC2 || Ser2 and Ser5 || In the pool of pol II? || From Giardia to human || In KInbase, conserved in yeast in the tree, but absent in the hits.&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | ERK1/2&lt;br /&gt;
| FUS3, KSS1, SLT2, SMK1, YKL161C ||  CMGC || MAPK || ERK1 || Ser5 || In the pool of pol II? || From Monosiga to human || Many yeast proteins in this subfamily of extracellular signal-related kinase 1/2 (ERK1 in KinBase).&lt;br /&gt;
|}&lt;br /&gt;
&lt;br /&gt;
== References==&lt;br /&gt;
&lt;br /&gt;
&amp;lt;biblio&amp;gt;&lt;br /&gt;
#Buratowski pmid=19941815&lt;br /&gt;
#Akhtar pmid=19450536&lt;br /&gt;
#Tietjen pmid=20802488&lt;br /&gt;
#Kim pmid=20835241 &lt;br /&gt;
#Yang pmid=15744326&lt;br /&gt;
#Chapman pmid=18472177&lt;br /&gt;
#Stiller pmid=11972039&lt;br /&gt;
#Egloff  pmid=18457900&lt;br /&gt;
#hsin2014 pmid=24752900&lt;br /&gt;
&amp;lt;/biblio&amp;gt;&lt;/div&gt;</summary>
		<author><name>Mark</name></author>	</entry>

	<entry>
		<id>http://www.phosphatome.net/wiki/index.php/CTD_Phosphorylation</id>
		<title>CTD Phosphorylation</title>
		<link rel="alternate" type="text/html" href="http://www.phosphatome.net/wiki/index.php/CTD_Phosphorylation"/>
				<updated>2016-05-14T23:06:30Z</updated>
		
		<summary type="html">&lt;p&gt;Mark: /* Phosphatases */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;[[Main_Page|Main Page]]:[[CTD_Phosphorylation|CTD Phosphorylation]]&lt;br /&gt;
&lt;br /&gt;
== Introduction ==&lt;br /&gt;
The C-terminal domain (CTD) of RNA polymerase II's largest subunit undergoes patterned dynamic phosphorylation during the transcription cycle. Each phosphorylation pattern recruits a particular set of mRNA-processing and histone-modifying factors. The CTD contains many copies of a heptapeptide repeat with 5 phosphorylation sites in the consensus sequence (Y1, S2, T4, S5, S7). ''In vivo'' phosphorylation occurs mainly on serine residues. This complex phosphorylation pattern is regulated by several phosphatases and kinases &amp;lt;cite&amp;gt;Buratowski&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
== Phosphatases == &lt;br /&gt;
{| border=&amp;quot;1&amp;quot; cellpadding=&amp;quot;5&amp;quot; cellspacing=&amp;quot;0&amp;quot; align=&amp;quot;center&amp;quot;&amp;quot;&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Mammals&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Yeast&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Group&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Family&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Substrate&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Stage&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Evolution (from yeast to human)&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Note&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | [[FCP1]] &lt;br /&gt;
| FCP1 || HAD || FCP || pSer2, pThr4 &amp;lt;cite&amp;gt;hsin2014&amp;lt;/cite&amp;gt; || To Recycling || From yeast to human || &lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | [[SCP]]&lt;br /&gt;
| SCP || HAD || FCP || pSer5 || To cleavage, polyA and termination || From yeast to human || The function toward pSer5 of one of its member, SCP1, has been verified in mammals, but not in yeast, yet.&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | [[SSU72]]&lt;br /&gt;
| SSU72 || CC2|| SSU72 || pSer5 || To cleavage, polyA and termination || From yeast to human ||  1) Its function toward pSer5 has been verified in yeast, but not mammals. 2) Unlike other phosphatases, it has a fold similar to LMWPTP rather than HAD.&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | [[HSPC129]]&lt;br /&gt;
| N/A || HAD || FCP || ? || ? || From Monosiga to human but lost in fly || 1) In vitro activity toward CTD. 2) HSPC129 was divergent from SCP family.&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | [[UBLCP1]]&lt;br /&gt;
| N/A || HAD || SCP || ? || ? || From anemone to human but lost in nematode || 1) In vitro activity toward CTD. &lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | RPAP2&lt;br /&gt;
| RTR1, RTR2 || RTR1 || RTR1 || RTR1 || pSer5, pTyr1 || RTR1 is found in most of eukaryotes. It is absent from Monosiga and sponge genome || &lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | ?&lt;br /&gt;
| N/A || ? || ? || pSer7 || ? || ? || Observed phosphorylated pSer7, but the phosphatase and kinase are unknown.&lt;br /&gt;
|}&lt;br /&gt;
&lt;br /&gt;
== Kinases ==&lt;br /&gt;
{| border=&amp;quot;1&amp;quot; cellpadding=&amp;quot;5&amp;quot; cellspacing=&amp;quot;0&amp;quot; align=&amp;quot;center&amp;quot;&amp;quot;&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Mammals&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Yeast&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Group&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Family&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Subfamily&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Substrate&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Stage&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Evolution&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Note&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | CDK7&lt;br /&gt;
| KIN28 || CMGC || CDK || CDK7 || Ser5, Ser7 || To initiation || From yeast to human but lost in Monosiga? || 1) CDK7 is a component of transcription factor TFIIH. 2) KinBase shows it is absent from Monosiga. &lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | CDK9&lt;br /&gt;
| Bur1 || CMGC || CDK || CDK9 || Ser2, Ser7 || To elongation || From yeast to human but lost in Monosiga? || 1) CDK9 is the catalytic subunit of the positive transcription elongation factor (P-TEF)b complex. 2) KinBase shows it is absent from Monosiga.&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | CRK7&lt;br /&gt;
| CTK1 || CMGC || CDK || CRK7 || Ser2 || To elongation || From Giardia to human but lost in Tetrahymena || It has been verified in yeast, but not in mammals.&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | CDK8&lt;br /&gt;
| CDK8 ||  CMGC || CDK || CDK8 || Ser2 and Ser5 || In the pool of pol II? || From yeast to human || &lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | CDC2&lt;br /&gt;
| CDK1 ||  CMGC || CDK || CDC2 || Ser2 and Ser5 || In the pool of pol II? || From Giardia to human || In KInbase, conserved in yeast in the tree, but absent in the hits.&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | ERK1/2&lt;br /&gt;
| FUS3, KSS1, SLT2, SMK1, YKL161C ||  CMGC || MAPK || ERK1 || Ser5 || In the pool of pol II? || From Monosiga to human || Many yeast proteins in this subfamily of extracellular signal-related kinase 1/2 (ERK1 in KinBase).&lt;br /&gt;
|}&lt;br /&gt;
&lt;br /&gt;
== References==&lt;br /&gt;
&lt;br /&gt;
&amp;lt;biblio&amp;gt;&lt;br /&gt;
#Buratowski pmid=19941815&lt;br /&gt;
#Akhtar pmid=19450536&lt;br /&gt;
#Tietjen pmid=20802488&lt;br /&gt;
#Kim pmid=20835241 &lt;br /&gt;
#Yang pmid=15744326&lt;br /&gt;
#Chapman pmid=18472177&lt;br /&gt;
#Stiller pmid=11972039&lt;br /&gt;
#Egloff  pmid=18457900&lt;br /&gt;
#hsin2014 pmid=24752900&lt;br /&gt;
&amp;lt;/biblio&amp;gt;&lt;/div&gt;</summary>
		<author><name>Mark</name></author>	</entry>

	<entry>
		<id>http://www.phosphatome.net/wiki/index.php/CTD_Phosphorylation</id>
		<title>CTD Phosphorylation</title>
		<link rel="alternate" type="text/html" href="http://www.phosphatome.net/wiki/index.php/CTD_Phosphorylation"/>
				<updated>2016-05-14T23:05:04Z</updated>
		
		<summary type="html">&lt;p&gt;Mark: /* Phosphatases */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;[[Main_Page|Main Page]]:[[CTD_Phosphorylation|CTD Phosphorylation]]&lt;br /&gt;
&lt;br /&gt;
== Introduction ==&lt;br /&gt;
The C-terminal domain (CTD) of RNA polymerase II's largest subunit undergoes patterned dynamic phosphorylation during the transcription cycle. Each phosphorylation pattern recruits a particular set of mRNA-processing and histone-modifying factors. The CTD contains many copies of a heptapeptide repeat with 5 phosphorylation sites in the consensus sequence (Y1, S2, T4, S5, S7). ''In vivo'' phosphorylation occurs mainly on serine residues. This complex phosphorylation pattern is regulated by several phosphatases and kinases &amp;lt;cite&amp;gt;Buratowski&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
== Phosphatases == &lt;br /&gt;
{| border=&amp;quot;1&amp;quot; cellpadding=&amp;quot;5&amp;quot; cellspacing=&amp;quot;0&amp;quot; align=&amp;quot;center&amp;quot;&amp;quot;&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Mammals&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Yeast&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Group&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Family&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Substrate&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Stage&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Evolution (from yeast to human)&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Note&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | [[FCP1]] &lt;br /&gt;
| FCP1 || HAD || FCP || pSer2, pThr4 &amp;lt;cite&amp;gt;hsin2014&amp;lt;/cite&amp;gt; || To Recycling || From yeast to human || &lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | [[SCP]]&lt;br /&gt;
| SCP || HAD || FCP || pSer5 || To cleavage, polyA and termination || From yeast to human || The function toward pSer5 of one of its member, SCP1, has been verified in mammals, but not in yeast, yet.&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | [[SSU72]]&lt;br /&gt;
| SSU72 || CC2|| SSU72 || pSer5 || To cleavage, polyA and termination || From yeast to human ||  1) Its function toward pSer5 has been verified in yeast, but not mammals. 2) Unlike other phosphatases, it has a fold similar to LMWPTP rather than HAD.&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | [[HSPC129]]&lt;br /&gt;
| N/A || HAD || FCP || ? || ? || From Monosiga to human but lost in fly || 1) In vitro activity toward CTD. 2) HSPC129 was divergent from SCP family.&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | [[UBLCP1]]&lt;br /&gt;
| N/A || HAD || SCP || ? || ? || From anemone to human but lost in nematode || 1) In vitro activity toward CTD. &lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | [[Phosphatase_Subfamily_RTR1|RTR1]]&lt;br /&gt;
| RTR1, RTR2 || RTR1 || RTR1 || RTR1 || pSer5 || From anemone to human but lost in nematode || 1) In vitro activity toward CTD. &lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | ?&lt;br /&gt;
| N/A || ? || ? || pSer7 || ? || ? || Observed phosphorylated pSer7, but the phosphatase and kinase are unknown.&lt;br /&gt;
|}&lt;br /&gt;
&lt;br /&gt;
== Kinases ==&lt;br /&gt;
{| border=&amp;quot;1&amp;quot; cellpadding=&amp;quot;5&amp;quot; cellspacing=&amp;quot;0&amp;quot; align=&amp;quot;center&amp;quot;&amp;quot;&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Mammals&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Yeast&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Group&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Family&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Subfamily&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Substrate&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Stage&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Evolution&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Note&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | CDK7&lt;br /&gt;
| KIN28 || CMGC || CDK || CDK7 || Ser5, Ser7 || To initiation || From yeast to human but lost in Monosiga? || 1) CDK7 is a component of transcription factor TFIIH. 2) KinBase shows it is absent from Monosiga. &lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | CDK9&lt;br /&gt;
| Bur1 || CMGC || CDK || CDK9 || Ser2, Ser7 || To elongation || From yeast to human but lost in Monosiga? || 1) CDK9 is the catalytic subunit of the positive transcription elongation factor (P-TEF)b complex. 2) KinBase shows it is absent from Monosiga.&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | CRK7&lt;br /&gt;
| CTK1 || CMGC || CDK || CRK7 || Ser2 || To elongation || From Giardia to human but lost in Tetrahymena || It has been verified in yeast, but not in mammals.&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | CDK8&lt;br /&gt;
| CDK8 ||  CMGC || CDK || CDK8 || Ser2 and Ser5 || In the pool of pol II? || From yeast to human || &lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | CDC2&lt;br /&gt;
| CDK1 ||  CMGC || CDK || CDC2 || Ser2 and Ser5 || In the pool of pol II? || From Giardia to human || In KInbase, conserved in yeast in the tree, but absent in the hits.&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | ERK1/2&lt;br /&gt;
| FUS3, KSS1, SLT2, SMK1, YKL161C ||  CMGC || MAPK || ERK1 || Ser5 || In the pool of pol II? || From Monosiga to human || Many yeast proteins in this subfamily of extracellular signal-related kinase 1/2 (ERK1 in KinBase).&lt;br /&gt;
|}&lt;br /&gt;
&lt;br /&gt;
== References==&lt;br /&gt;
&lt;br /&gt;
&amp;lt;biblio&amp;gt;&lt;br /&gt;
#Buratowski pmid=19941815&lt;br /&gt;
#Akhtar pmid=19450536&lt;br /&gt;
#Tietjen pmid=20802488&lt;br /&gt;
#Kim pmid=20835241 &lt;br /&gt;
#Yang pmid=15744326&lt;br /&gt;
#Chapman pmid=18472177&lt;br /&gt;
#Stiller pmid=11972039&lt;br /&gt;
#Egloff  pmid=18457900&lt;br /&gt;
#hsin2014 pmid=24752900&lt;br /&gt;
&amp;lt;/biblio&amp;gt;&lt;/div&gt;</summary>
		<author><name>Mark</name></author>	</entry>

	<entry>
		<id>http://www.phosphatome.net/wiki/index.php/CTD_Phosphorylation</id>
		<title>CTD Phosphorylation</title>
		<link rel="alternate" type="text/html" href="http://www.phosphatome.net/wiki/index.php/CTD_Phosphorylation"/>
				<updated>2016-05-14T23:03:18Z</updated>
		
		<summary type="html">&lt;p&gt;Mark: /* Phosphatases */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;[[Main_Page|Main Page]]:[[CTD_Phosphorylation|CTD Phosphorylation]]&lt;br /&gt;
&lt;br /&gt;
== Introduction ==&lt;br /&gt;
The C-terminal domain (CTD) of RNA polymerase II's largest subunit undergoes patterned dynamic phosphorylation during the transcription cycle. Each phosphorylation pattern recruits a particular set of mRNA-processing and histone-modifying factors. The CTD contains many copies of a heptapeptide repeat with 5 phosphorylation sites in the consensus sequence (Y1, S2, T4, S5, S7). ''In vivo'' phosphorylation occurs mainly on serine residues. This complex phosphorylation pattern is regulated by several phosphatases and kinases &amp;lt;cite&amp;gt;Buratowski&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
== Phosphatases == &lt;br /&gt;
{| border=&amp;quot;1&amp;quot; cellpadding=&amp;quot;5&amp;quot; cellspacing=&amp;quot;0&amp;quot; align=&amp;quot;center&amp;quot;&amp;quot;&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Mammals&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Yeast&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Group&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Family&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Substrate&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Stage&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Evolution (from yeast to human)&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Note&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | [[FCP1]] &lt;br /&gt;
| FCP1 || HAD || FCP || pSer2, pThr4 &amp;lt;cite&amp;gt;hsin2014&amp;lt;/cite&amp;gt; || To Recycling || From yeast to human || &lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | [[SCP]]&lt;br /&gt;
| SCP || HAD || FCP || pSer5 || To cleavage, polyA and termination || From yeast to human || The function toward pSer5 of one of its member, SCP1, has been verified in mammals, but not in yeast, yet.&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | [[SSU72]]&lt;br /&gt;
| SSU72 || CC2|| SSU72 || pSer5 || To cleavage, polyA and termination || From yeast to human ||  1) Its function toward pSer5 has been verified in yeast, but not mammals. 2) Unlike other phosphatases, it has a fold similar to LMWPTP rather than HAD.&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | [[HSPC129]]&lt;br /&gt;
| N/A || HAD || FCP || ? || ? || From Monosiga to human but lost in fly || 1) In vitro activity toward CTD. 2) HSPC129 was divergent from SCP family.&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | [[UBLCP1]]&lt;br /&gt;
| N/A || HAD || SCP || ? || ? || From anemone to human but lost in nematode || 1) In vitro activity toward CTD. &lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | [[UBLCP1]]&lt;br /&gt;
| pSer5 || RTR1 || RTR1 || RTR1 || pSer5 || From anemone to human but lost in nematode || 1) In vitro activity toward CTD. &lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | ?&lt;br /&gt;
| N/A || ? || ? || pSer7 || ? || ? || Observed phosphorylated pSer7, but the phosphatase and kinase are unknown.&lt;br /&gt;
|}&lt;br /&gt;
&lt;br /&gt;
== Kinases ==&lt;br /&gt;
{| border=&amp;quot;1&amp;quot; cellpadding=&amp;quot;5&amp;quot; cellspacing=&amp;quot;0&amp;quot; align=&amp;quot;center&amp;quot;&amp;quot;&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Mammals&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Yeast&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Group&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Family&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Subfamily&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Substrate&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Stage&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Evolution&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Note&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | CDK7&lt;br /&gt;
| KIN28 || CMGC || CDK || CDK7 || Ser5, Ser7 || To initiation || From yeast to human but lost in Monosiga? || 1) CDK7 is a component of transcription factor TFIIH. 2) KinBase shows it is absent from Monosiga. &lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | CDK9&lt;br /&gt;
| Bur1 || CMGC || CDK || CDK9 || Ser2, Ser7 || To elongation || From yeast to human but lost in Monosiga? || 1) CDK9 is the catalytic subunit of the positive transcription elongation factor (P-TEF)b complex. 2) KinBase shows it is absent from Monosiga.&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | CRK7&lt;br /&gt;
| CTK1 || CMGC || CDK || CRK7 || Ser2 || To elongation || From Giardia to human but lost in Tetrahymena || It has been verified in yeast, but not in mammals.&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | CDK8&lt;br /&gt;
| CDK8 ||  CMGC || CDK || CDK8 || Ser2 and Ser5 || In the pool of pol II? || From yeast to human || &lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | CDC2&lt;br /&gt;
| CDK1 ||  CMGC || CDK || CDC2 || Ser2 and Ser5 || In the pool of pol II? || From Giardia to human || In KInbase, conserved in yeast in the tree, but absent in the hits.&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | ERK1/2&lt;br /&gt;
| FUS3, KSS1, SLT2, SMK1, YKL161C ||  CMGC || MAPK || ERK1 || Ser5 || In the pool of pol II? || From Monosiga to human || Many yeast proteins in this subfamily of extracellular signal-related kinase 1/2 (ERK1 in KinBase).&lt;br /&gt;
|}&lt;br /&gt;
&lt;br /&gt;
== References==&lt;br /&gt;
&lt;br /&gt;
&amp;lt;biblio&amp;gt;&lt;br /&gt;
#Buratowski pmid=19941815&lt;br /&gt;
#Akhtar pmid=19450536&lt;br /&gt;
#Tietjen pmid=20802488&lt;br /&gt;
#Kim pmid=20835241 &lt;br /&gt;
#Yang pmid=15744326&lt;br /&gt;
#Chapman pmid=18472177&lt;br /&gt;
#Stiller pmid=11972039&lt;br /&gt;
#Egloff  pmid=18457900&lt;br /&gt;
#hsin2014 pmid=24752900&lt;br /&gt;
&amp;lt;/biblio&amp;gt;&lt;/div&gt;</summary>
		<author><name>Mark</name></author>	</entry>

	<entry>
		<id>http://www.phosphatome.net/wiki/index.php/CTD_Phosphorylation</id>
		<title>CTD Phosphorylation</title>
		<link rel="alternate" type="text/html" href="http://www.phosphatome.net/wiki/index.php/CTD_Phosphorylation"/>
				<updated>2016-05-14T23:01:57Z</updated>
		
		<summary type="html">&lt;p&gt;Mark: /* Kinases */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;[[Main_Page|Main Page]]:[[CTD_Phosphorylation|CTD Phosphorylation]]&lt;br /&gt;
&lt;br /&gt;
== Introduction ==&lt;br /&gt;
The C-terminal domain (CTD) of RNA polymerase II's largest subunit undergoes patterned dynamic phosphorylation during the transcription cycle. Each phosphorylation pattern recruits a particular set of mRNA-processing and histone-modifying factors. The CTD contains many copies of a heptapeptide repeat with 5 phosphorylation sites in the consensus sequence (Y1, S2, T4, S5, S7). ''In vivo'' phosphorylation occurs mainly on serine residues. This complex phosphorylation pattern is regulated by several phosphatases and kinases &amp;lt;cite&amp;gt;Buratowski&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
== Phosphatases == &lt;br /&gt;
{| border=&amp;quot;1&amp;quot; cellpadding=&amp;quot;5&amp;quot; cellspacing=&amp;quot;0&amp;quot; align=&amp;quot;center&amp;quot;&amp;quot;&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Mammals&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Yeast&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Group&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Family&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Substrate&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Stage&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Evolution (from yeast to human)&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Note&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | [[FCP1]] &lt;br /&gt;
| FCP1 || HAD || FCP || pSer2, pThr4 &amp;lt;cite&amp;gt;hsin2014&amp;lt;/cite&amp;gt; || To Recycling || From yeast to human || &lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | [[SCP]]&lt;br /&gt;
| SCP || HAD || FCP || pSer5 || To cleavage, polyA and termination || From yeast to human || The function toward pSer5 of one of its member, SCP1, has been verified in mammals, but not in yeast, yet.&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | [[SSU72]]&lt;br /&gt;
| SSU72 || CC2|| SSU72 || pSer5 || To cleavage, polyA and termination || From yeast to human ||  1) Its function toward pSer5 has been verified in yeast, but not mammals. 2) Unlike other phosphatases, it has a fold similar to LMWPTP rather than HAD.&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | [[HSPC129]]&lt;br /&gt;
| N/A || HAD || FCP || ? || ? || From Monosiga to human but lost in fly || 1) In vitro activity toward CTD. 2) HSPC129 was divergent from SCP family.&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | [[UBLCP1]]&lt;br /&gt;
| N/A || HAD || SCP || ? || ? || From anemone to human but lost in nematode || 1) In vitro activity toward CTD. &lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | ?&lt;br /&gt;
| N/A || ? || ? || pSer7 || ? || ? || Observed phosphorylated pSer7, but the phosphatase and kinase are unknown.&lt;br /&gt;
|}&lt;br /&gt;
&lt;br /&gt;
== Kinases ==&lt;br /&gt;
{| border=&amp;quot;1&amp;quot; cellpadding=&amp;quot;5&amp;quot; cellspacing=&amp;quot;0&amp;quot; align=&amp;quot;center&amp;quot;&amp;quot;&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Mammals&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Yeast&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Group&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Family&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Subfamily&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Substrate&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Stage&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Evolution&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Note&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | CDK7&lt;br /&gt;
| KIN28 || CMGC || CDK || CDK7 || Ser5, Ser7 || To initiation || From yeast to human but lost in Monosiga? || 1) CDK7 is a component of transcription factor TFIIH. 2) KinBase shows it is absent from Monosiga. &lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | CDK9&lt;br /&gt;
| Bur1 || CMGC || CDK || CDK9 || Ser2, Ser7 || To elongation || From yeast to human but lost in Monosiga? || 1) CDK9 is the catalytic subunit of the positive transcription elongation factor (P-TEF)b complex. 2) KinBase shows it is absent from Monosiga.&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | CRK7&lt;br /&gt;
| CTK1 || CMGC || CDK || CRK7 || Ser2 || To elongation || From Giardia to human but lost in Tetrahymena || It has been verified in yeast, but not in mammals.&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | CDK8&lt;br /&gt;
| CDK8 ||  CMGC || CDK || CDK8 || Ser2 and Ser5 || In the pool of pol II? || From yeast to human || &lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | CDC2&lt;br /&gt;
| CDK1 ||  CMGC || CDK || CDC2 || Ser2 and Ser5 || In the pool of pol II? || From Giardia to human || In KInbase, conserved in yeast in the tree, but absent in the hits.&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | ERK1/2&lt;br /&gt;
| FUS3, KSS1, SLT2, SMK1, YKL161C ||  CMGC || MAPK || ERK1 || Ser5 || In the pool of pol II? || From Monosiga to human || Many yeast proteins in this subfamily of extracellular signal-related kinase 1/2 (ERK1 in KinBase).&lt;br /&gt;
|}&lt;br /&gt;
&lt;br /&gt;
== References==&lt;br /&gt;
&lt;br /&gt;
&amp;lt;biblio&amp;gt;&lt;br /&gt;
#Buratowski pmid=19941815&lt;br /&gt;
#Akhtar pmid=19450536&lt;br /&gt;
#Tietjen pmid=20802488&lt;br /&gt;
#Kim pmid=20835241 &lt;br /&gt;
#Yang pmid=15744326&lt;br /&gt;
#Chapman pmid=18472177&lt;br /&gt;
#Stiller pmid=11972039&lt;br /&gt;
#Egloff  pmid=18457900&lt;br /&gt;
#hsin2014 pmid=24752900&lt;br /&gt;
&amp;lt;/biblio&amp;gt;&lt;/div&gt;</summary>
		<author><name>Mark</name></author>	</entry>

	<entry>
		<id>http://www.phosphatome.net/wiki/index.php/CTD_Phosphorylation</id>
		<title>CTD Phosphorylation</title>
		<link rel="alternate" type="text/html" href="http://www.phosphatome.net/wiki/index.php/CTD_Phosphorylation"/>
				<updated>2016-05-14T23:01:33Z</updated>
		
		<summary type="html">&lt;p&gt;Mark: /* Kinases */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;[[Main_Page|Main Page]]:[[CTD_Phosphorylation|CTD Phosphorylation]]&lt;br /&gt;
&lt;br /&gt;
== Introduction ==&lt;br /&gt;
The C-terminal domain (CTD) of RNA polymerase II's largest subunit undergoes patterned dynamic phosphorylation during the transcription cycle. Each phosphorylation pattern recruits a particular set of mRNA-processing and histone-modifying factors. The CTD contains many copies of a heptapeptide repeat with 5 phosphorylation sites in the consensus sequence (Y1, S2, T4, S5, S7). ''In vivo'' phosphorylation occurs mainly on serine residues. This complex phosphorylation pattern is regulated by several phosphatases and kinases &amp;lt;cite&amp;gt;Buratowski&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
== Phosphatases == &lt;br /&gt;
{| border=&amp;quot;1&amp;quot; cellpadding=&amp;quot;5&amp;quot; cellspacing=&amp;quot;0&amp;quot; align=&amp;quot;center&amp;quot;&amp;quot;&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Mammals&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Yeast&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Group&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Family&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Substrate&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Stage&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Evolution (from yeast to human)&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Note&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | [[FCP1]] &lt;br /&gt;
| FCP1 || HAD || FCP || pSer2, pThr4 &amp;lt;cite&amp;gt;hsin2014&amp;lt;/cite&amp;gt; || To Recycling || From yeast to human || &lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | [[SCP]]&lt;br /&gt;
| SCP || HAD || FCP || pSer5 || To cleavage, polyA and termination || From yeast to human || The function toward pSer5 of one of its member, SCP1, has been verified in mammals, but not in yeast, yet.&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | [[SSU72]]&lt;br /&gt;
| SSU72 || CC2|| SSU72 || pSer5 || To cleavage, polyA and termination || From yeast to human ||  1) Its function toward pSer5 has been verified in yeast, but not mammals. 2) Unlike other phosphatases, it has a fold similar to LMWPTP rather than HAD.&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | [[HSPC129]]&lt;br /&gt;
| N/A || HAD || FCP || ? || ? || From Monosiga to human but lost in fly || 1) In vitro activity toward CTD. 2) HSPC129 was divergent from SCP family.&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | [[UBLCP1]]&lt;br /&gt;
| N/A || HAD || SCP || ? || ? || From anemone to human but lost in nematode || 1) In vitro activity toward CTD. &lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | ?&lt;br /&gt;
| N/A || ? || ? || pSer7 || ? || ? || Observed phosphorylated pSer7, but the phosphatase and kinase are unknown.&lt;br /&gt;
|}&lt;br /&gt;
&lt;br /&gt;
== Kinases ==&lt;br /&gt;
{| border=&amp;quot;1&amp;quot; cellpadding=&amp;quot;5&amp;quot; cellspacing=&amp;quot;0&amp;quot; align=&amp;quot;center&amp;quot;&amp;quot;&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Mammals&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Yeast&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Group&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Family&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Subfamily&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Substrate&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Stage&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Evolution&lt;br /&gt;
! scope=&amp;quot;col&amp;quot; | Note&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | CDK7&lt;br /&gt;
| KIN28 || CMGC || CDK || CDK7 || Ser5, Ser7 || To initiation || From yeast to human but lost in Monosiga? || 1) CDK7 is a component of transcription factor TFIIH. 2) KinBase shows it is absent from Monosiga. &lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | CDK9&lt;br /&gt;
| Bur1 || CMGC || CDK || CDK9 || Ser2, Ser7 || To elongation || From yeast to human but lost in Monosiga? || 1) CDK9 is the catalytic subunit of the positive transcription elongation factor (P-TEF)b complex. 2) KinBase shows it is absent from Monosiga.&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | CRK7&lt;br /&gt;
| CTK1 || CMGC || CDK || CRK7 || Ser2 || To elongation || From Giardia to human but lost in Tetrahymena || It has been verified in yeast, but not in mammals.&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | CDK8&lt;br /&gt;
| CDK8 ||  CMGC || CDK || CDK8 || Ser2 and Ser5 || In the pool of pol II? || From yeast to human || &lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | CDC2&lt;br /&gt;
| CDK1 ||  CMGC || CDK || CDC2 || Ser2 and Ser5 || In the pool of pol II? || From Giardia to human || In KInbase, conserved in yeast in the tree, but absent in the hits.&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | ERK1/2&lt;br /&gt;
| FUS3, KSS1, SLT2, SMK1, YKL161C ||  CMGC || MAPK || ERK1 || Ser5 || In the pool of pol II? || From Monosiga to human || Many yeast proteins in this subfamily of extracellular signal-related kinase 1/2 (ERK1 in KinBase).&lt;br /&gt;
|-&lt;br /&gt;
! scope=&amp;quot;row&amp;quot; | ?&lt;br /&gt;
| ? || ? || ? || ? || Ser7 || ? || ? || ?&lt;br /&gt;
|}&lt;br /&gt;
&lt;br /&gt;
== References==&lt;br /&gt;
&lt;br /&gt;
&amp;lt;biblio&amp;gt;&lt;br /&gt;
#Buratowski pmid=19941815&lt;br /&gt;
#Akhtar pmid=19450536&lt;br /&gt;
#Tietjen pmid=20802488&lt;br /&gt;
#Kim pmid=20835241 &lt;br /&gt;
#Yang pmid=15744326&lt;br /&gt;
#Chapman pmid=18472177&lt;br /&gt;
#Stiller pmid=11972039&lt;br /&gt;
#Egloff  pmid=18457900&lt;br /&gt;
#hsin2014 pmid=24752900&lt;br /&gt;
&amp;lt;/biblio&amp;gt;&lt;/div&gt;</summary>
		<author><name>Mark</name></author>	</entry>

	<entry>
		<id>http://www.phosphatome.net/wiki/index.php/Phosphatase_GeneID_MbreP062</id>
		<title>Phosphatase GeneID MbreP062</title>
		<link rel="alternate" type="text/html" href="http://www.phosphatome.net/wiki/index.php/Phosphatase_GeneID_MbreP062"/>
				<updated>2016-05-11T22:06:42Z</updated>
		
		<summary type="html">&lt;p&gt;Mark: Created page with &amp;quot;The domain combination of PTP and PDZ is supported by S. rosetta XP_004995601.1 and M. ovata BAJ52657.1.&amp;quot;&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;The domain combination of PTP and PDZ is supported by S. rosetta XP_004995601.1 and M. ovata BAJ52657.1.&lt;/div&gt;</summary>
		<author><name>Mark</name></author>	</entry>

	<entry>
		<id>http://www.phosphatome.net/wiki/index.php/Phosphatase_GeneID_MbreP044</id>
		<title>Phosphatase GeneID MbreP044</title>
		<link rel="alternate" type="text/html" href="http://www.phosphatome.net/wiki/index.php/Phosphatase_GeneID_MbreP044"/>
				<updated>2016-05-11T18:10:54Z</updated>
		
		<summary type="html">&lt;p&gt;Mark: Created page with &amp;quot;The presence of WW domain is supported by XP_004997059 (S. Rosetta) and BAJ52652 (M. ovata). The two sequences have an additional EF-hand domain at the C-terminal, which is ab...&amp;quot;&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;The presence of WW domain is supported by XP_004997059 (S. Rosetta) and BAJ52652 (M. ovata). The two sequences have an additional EF-hand domain at the C-terminal, which is absent from this Mbre gene model.&lt;/div&gt;</summary>
		<author><name>Mark</name></author>	</entry>

	<entry>
		<id>http://www.phosphatome.net/wiki/index.php/Phosphatase_GeneID_MbreP035</id>
		<title>Phosphatase GeneID MbreP035</title>
		<link rel="alternate" type="text/html" href="http://www.phosphatome.net/wiki/index.php/Phosphatase_GeneID_MbreP035"/>
				<updated>2016-05-10T21:37:04Z</updated>
		
		<summary type="html">&lt;p&gt;Mark: Created page with &amp;quot;The full sequence is longer than Entrez gene model (protein sequence XP_001745699.1). It is supported by S. Rosetta XP_004998982.1.  MRYQDFYDIGRDQPATASYANPNLLKNRYGNIVAYDAGRVKL...&amp;quot;&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;The full sequence is longer than Entrez gene model (protein sequence XP_001745699.1). It is supported by S. Rosetta XP_004998982.1.&lt;br /&gt;
&lt;br /&gt;
MRYQDFYDIGRDQPATASYANPNLLKNRYGNIVAYDAGRVKLSQIGDDPSTDYINASWVDAYKQPNGYIASQGPVPNSFLDFWRMVWEQNACTIVMVTHEVEKGRIKCHRYWPDPTSTPPTQTLSYGDVTVTHLRAEAHRHFVVRTFLVRCNSEERTVKQFAYTSWPDHGVPLTTAELLGFRNAVNAGTPNKDVPIVIHCSAGVGRTGTYIAIDTLVKQCLDMGGMPNVDAVVRDMRLRRNYMVQTEMQYIFIYRAVYDCLNELLKTESTKAEQLATSQAEQQALRDAAEAADRAKQEEEERERAAIEEARKALEREELARGEASAAQARAIISLSLSERKSMLQAAEEQWLINYQQSLAEWNDRNQFAAEQYDTTSELTPVQSRLEALRQKGMLI&lt;/div&gt;</summary>
		<author><name>Mark</name></author>	</entry>

	<entry>
		<id>http://www.phosphatome.net/wiki/index.php/Phosphatase_GeneID_MbreP068</id>
		<title>Phosphatase GeneID MbreP068</title>
		<link rel="alternate" type="text/html" href="http://www.phosphatome.net/wiki/index.php/Phosphatase_GeneID_MbreP068"/>
				<updated>2016-05-10T18:46:38Z</updated>
		
		<summary type="html">&lt;p&gt;Mark: Created page with &amp;quot;We update the gene model using cDNA GenBank: KM609288.1 reported of cloning Monosiga SHP &amp;lt;cite&amp;gt;Zhao14&amp;lt;/cite&amp;gt;.  == References == &amp;lt;biblio&amp;gt; #Zhao14 pmid=25445586 &amp;lt;/biblio&amp;gt;&amp;quot;&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;We update the gene model using cDNA GenBank: KM609288.1 reported of cloning Monosiga SHP &amp;lt;cite&amp;gt;Zhao14&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
== References ==&lt;br /&gt;
&amp;lt;biblio&amp;gt;&lt;br /&gt;
#Zhao14 pmid=25445586&lt;br /&gt;
&amp;lt;/biblio&amp;gt;&lt;/div&gt;</summary>
		<author><name>Mark</name></author>	</entry>

	<entry>
		<id>http://www.phosphatome.net/wiki/index.php/Phosphatase_Family_PTP</id>
		<title>Phosphatase Family PTP</title>
		<link rel="alternate" type="text/html" href="http://www.phosphatome.net/wiki/index.php/Phosphatase_Family_PTP"/>
				<updated>2016-05-10T17:53:27Z</updated>
		
		<summary type="html">&lt;p&gt;Mark: /* Receptor PTPs */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;__NOTOC__&lt;br /&gt;
[[Phosphatase classification|Phosphatase Classification]]: [[Phosphatase_Fold_CC1|Fold CC1]]: [[Phosphatase_Superfamily_CC1|Superfamily CC1]]:  [[Phosphatase_Family_PTP|Family PTP]]&lt;br /&gt;
&lt;br /&gt;
The Protein Tyrosine Phosphatase Family (PTP) is the major tyrosine-specific family of phosphatases, present throughout animals and consisting of both transmembrane receptors (rPTPs) and non-receptor phosphatases (nrPTP), in several distinct subfamilies. This subfamily is known as High Molecular Weight Protein Tyrosine Phosphatase (HMWPTP) in the [http://scop.berkeley.edu/sunid=52805 SCOP database]. Compared to the related [[Phosphatase_Family_DSP|DSP]] and [[Phosphatase_Family_PTEN|PTEN]] families, it has an extension to the beta-sheet of 3 antiparallel strands before strand 4. &lt;br /&gt;
&lt;br /&gt;
=== Evolution ===&lt;br /&gt;
PTPs first emerged in holozoa. Among the 17 subfamilies present in human, 6 emerged in holozoa, 5 in metazoa, 3 in eumetazoa, and 3 in chordates or vertebrates. The relationship between the subfamilies is not well understood. The relationships between non-receptor PTPs and those between PTPRN and PTPRR/N5 and other subfamilies, as depicted by tree, are not significantly supported by statistical test; meanwhile, the trees in different studies have different topologies as you can image &amp;lt;cite&amp;gt;Andersen01, Andersen04, Barr09&amp;lt;/cite&amp;gt; (as well as [http://ptp.cshl.edu/proteinclass.shtml PTP website at CSHL]).&lt;br /&gt;
&lt;br /&gt;
=== Subfamilies ===&lt;br /&gt;
The PTPs can be grouped into two classes: receptor PTPs and non-receptor PTPs.&lt;br /&gt;
&lt;br /&gt;
==== Receptor PTPs ====&lt;br /&gt;
Receptor PTPs usually have an extracellular region, a single transmembrane region, and one or two intracytoplasmic catalytic phosphatase domains. Some receptor PTPs encode isoforms without extracellular or transmembrane regions, which function as non-receptor PTPs.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPRA|PTPRA]] is a deuterostome-specific subfamily. Human members are PTPRA (HEPTP/R-PTP-alpha) and PTPRE (R-PTP-EPSILON).&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPRC|PTPRC]] (CD45) is a vertebrate-specific subfamily involved in lymphocyte activation. In particular, it dephosphorylates and activates Src kinases.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPRD|PTPRD]] (LAR) functions in the nervous system. The three human members, PTPRF (LAR), PTPRD (RPTPdelta) and PTPRS (RPTPsigma) dephosphorylate different proteins mostly involved in cell signaling. PTPRD is found in animals and choanoflagellates.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPRG|PTPRG]] is an eumetazoan subfamily that functions in nervous system and maybe cancer. Humans have two members, PTPRG (R-PTP-GAMMA) and PTPRZ1 (RPTPbeta/R-PTP-zeta-2/Rptpζ), which can interact with other PTPs, such as PTPRD.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPRK|PTPRK]] (R2B) is a chordate subfamily that regulates cell-cell adhesion, implicated in human cancer and the nervous system. The four human members are  PTPRK (R-PTP-kappa), PTPRM (PTP mu), PTPRT (RPTPrho), and PTPRU (PTP-RO/hPTP-J/PTP pi/PTP lambda).&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPRB|PTPRB]] (R3) is a metazoan-specific subfamily with functions in the nervous and immune systems. Human has five members: PTPRB (VE-PTP), PTPRH (SAP-1), PTPRJ (CD148/DEP1/RPTP eta), PTPRO (GLEPP1/PTP phi), and PTPRQ. They have distinct substrates. PTPRQ is lipid phosphatase rather than tyrosine phosphatase. &lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPRN|PTPRN]] (IA-2) is a metazoan family involved in neuronal and endocrine vesicle trafficking. No members have shown protein phosphatase activity, but at least one is reported to be a phospholipid phosphatase.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPN5_RR|PTPRR]] (STEP) is a eumetazoan subfamily duplicated in vertebrates but absent from nematodes. . It is characterized by a kinase interaction motif (KIM), which is regulated by the phosphorylation state of a serine within the motif. Human has three members: PTPN5/STEP, PTPN7/HePTP, PTPRR/PTP-SL. Two of the three members have predicted transmembrane regions. They all regulate ERK pathway, but may have their specific substrates. They are expressed in different tissues, particularly, abundant in spleen, thymus, and different parts of brain.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_Ptp69D|Ptp69D]] is a subfamily similar to PTPRD. It is involved in neuronal pathfinding. It emerged in metazoa but is absent from vertebrates.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_CG42327|CG42327]] is found in arthropods. Its function is unclear.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_NvecPTP-sf2|NvecPTP-sf2]] is found in cnidarians, and is of unknown function.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_SpurPTP-sf1|SpurPTP-sf1]], [[Phosphatase_Subfamily_SpurPTP-sf3|SpurPTP-sf3]], [[Phosphatase_Subfamily_SpurPTP-sf4|SpurPTP-sf4]] are found in the sea urchin and have no known functions.&lt;br /&gt;
&lt;br /&gt;
==== Non-receptor PTPs ====&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPN1|PTPN1]] dephosphorylates various families of kinases. It emerged in animals and duplicated in vertebrates. Human has two members, PTPN1 (PTP1B) and PTPN2 (TCPTP).&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPN3|PTPN3]] emerged in holozoa and duplicated in vertebrates. It has a domain combination of FERM domain, PEST sequence, PDZ domain and phosphatase domain. Human has two members of this subfamily, PTPN3 (PTPH1) and PTPN4 (PTPMEG). The expression pattern, substrates and interacting partners of PTPN3 and PTPN4 have limited overlap.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPN6|PTPN6]] (SHP) is implicated in cancer and diabetes. It emerged in holozoa and duplicated in vertebrates. It is characterized by tandem SH2 domains. &lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPN9|PTPN9]] is a metazoan subfamily functions in regulated secretory pathway. It has a characteristic accessory domain, a N-terminal Sec14p homology domain, which localizes it to secretory vesicles.  &lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPN12|PTPN12]] is a cytosolic PTP subfamily emerged in holozoan, duplicated in vertebrates and lost in ecdysozoan. It has a N-terminal phosphatase domain and a C-terminal region containing several proline-rich sequences. Human has three members, PTPN12/PTP-PEST, PTPN18/BDP and PTPN22/LYP. PTPN22/LYP variant R620W is associated with various autoimmune diseases, rheumatoid arthritis (RA), systemic lupus erythematosus (SLE), type 1 diabetes (T1D).&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPN13|PTPN13]] is a cytosolic PTP subfamily that has diverse functions. It has various substrates and interacting partners. PTPN13 has a FERM domain localizing it to plasma membrane, five PDZ domains interacting with different proteins, and a phosphatase domain. PTPN13 probably emerged in holozoan, but lost in various metazoan lineages such as ecdysozoan. PTPN13 has a single member in human: PTPN13/FAP-1/PTP1E/PTPL1/PTP-BAS.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPN14|PTPN14]] (PEZ) is a cytoskeletal-associated phosphatase with roles in cell migration and adhesion, EGFR signaling and regulation of the Hippo pathway. PTPRN14 emerged in metazoa; it is lost in all nematodes and duplicated in vertebrates.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPN20|PTPN20]] is a phosphatase involved in cytoskeleton organization. It emerged in sarcopterygii.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPN23|PTPN23]] (HD-PTP) functions in endosomal protein sorting. It has a signature BRO1 domain that distinguishes it from other protein phosphatases. It is under debate whether PTPN23 is catalytically inactive. PTPN23 emerged in holozoan but absent from some individual lineages, such as sponge and nematode.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_Ptp36E|Ptp36E]] (CG7180) is a ecdysozoan-specific subfamily found in both nematodes and arthropods. Its function is unclear. Interestingly, it has two tandem PTP domains, which is a signature of receptor PTPs, and is similar to PTPRK, but lacks a transmembrane region or signal peptide.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_eak|Eak]] is a nematode-specific subfamily. ''C. elegans'' has two members eak-6 and sdf-9/eak-5 which potentiate AKT-1/PKB signaling. The function seems independent of phosphatase activity, because sdf-9 is predicted to be catalytically inactive given the replacement of cysteine by serine at the Cx5R motif. &lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_egg|Egg]] is a nematode-specific subfamily of pseudophosphatases. ''C. elegans'' has three members  egg-3, egg-4, egg-5. Egg-4/egg-5 binds to the substrate-binding site of the kinase MBK-2 and inhibits the kinase to bind and phoshorylate its substrate, thereby inhibiting downstream signaling.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_ptpB|PtpB]] (a.k.a. [http://dictybase.org/gene/DDB_G0277865 PTP2 in Dictyostelium discoideum]) is a subfamily found in most species in the order of Dictyosteliida (protein domain sequence identify &amp;gt;40%). In the species of Dictyostelium, it regulates MAP kinase ERK1 &amp;lt;cite&amp;gt;Sun11&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_ptpC|PtpC]] (a.k.a. [http://dictybase.org/gene/DDB_G0282145 PTP3 in Dictyostelium discoideum]) is a subfamily found in some species in the order of Dictyosteliida (protein domain sequence identify &amp;gt;70%). In the species of Dictyostelium, it is involved in STAT signaling pathway, downstream of [http://kinase.com/web/current/kinbase/genes/Family/DPYK/ Dictyostelium protein tyrosine kinase] (DPYK) &amp;lt;cite&amp;gt;Sun11&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_MbrePTP-sf1|MbrePTP-sf1]] is one of several clade-specific subfamilies that have no known functions.&lt;br /&gt;
&lt;br /&gt;
=== Phosphatase Domain ===&lt;br /&gt;
The PTP phosphatase domain (PD) has ten motifs &amp;lt;cite&amp;gt;Andersen01&amp;lt;/cite&amp;gt;. The motif 1 (nxxKNRY) is proposed to be pTr-recognition loop. The Y is substituted in i) D2 domain of human receptor PTPs, ii) catalytically inactive PTPs, including PTPRN, PTPN14, and PTPN23, iii) lipid phosphatases PTPRQ and PTPRN2. &lt;br /&gt;
&lt;br /&gt;
==== Second phosphatase domain (D2) ====&lt;br /&gt;
'''PTPRC'''. D2 is necessary for PTPRC (CD45). The loss of D1 PTP activity after the deletion of all or even small portions of the D2 PTP domain &amp;lt;cite&amp;gt; Ng95, Wang00 &amp;lt;/cite&amp;gt;. PTPRC (CD45) has a 19-aa acidic region in D2 domain, which serves as a regulatory module in lymphocyte activation &amp;lt;cite&amp;gt; Wang00 &amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
'''PTPRA'''. The D2 of PTPRA demonstrated higher susceptibility to oxidation &amp;lt;cite&amp;gt;Persson04&amp;lt;/cite&amp;gt;. The oxidation at the cysteine of Cx5R catalytic motif led to inactivation in PTPN1 (PTP1B).&lt;br /&gt;
&lt;br /&gt;
=== References ===&lt;br /&gt;
&amp;lt;biblio&amp;gt;&lt;br /&gt;
#Andersen01 pmid=11585896&lt;br /&gt;
#Andersen04 pmid=14718383&lt;br /&gt;
#Barr09 pmid=19167335&lt;br /&gt;
#Ng95 pmid=7818534&lt;br /&gt;
#Persson04 pmid=14762163&lt;br /&gt;
#Sun11 pmid=21776390&lt;br /&gt;
#Wang00 pmid=10679094&lt;br /&gt;
&amp;lt;/biblio&amp;gt;&lt;/div&gt;</summary>
		<author><name>Mark</name></author>	</entry>

	<entry>
		<id>http://www.phosphatome.net/wiki/index.php/Phosphatase_Family_PTP</id>
		<title>Phosphatase Family PTP</title>
		<link rel="alternate" type="text/html" href="http://www.phosphatome.net/wiki/index.php/Phosphatase_Family_PTP"/>
				<updated>2016-05-10T17:52:43Z</updated>
		
		<summary type="html">&lt;p&gt;Mark: /* Non-receptor PTPs */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;__NOTOC__&lt;br /&gt;
[[Phosphatase classification|Phosphatase Classification]]: [[Phosphatase_Fold_CC1|Fold CC1]]: [[Phosphatase_Superfamily_CC1|Superfamily CC1]]:  [[Phosphatase_Family_PTP|Family PTP]]&lt;br /&gt;
&lt;br /&gt;
The Protein Tyrosine Phosphatase Family (PTP) is the major tyrosine-specific family of phosphatases, present throughout animals and consisting of both transmembrane receptors (rPTPs) and non-receptor phosphatases (nrPTP), in several distinct subfamilies. This subfamily is known as High Molecular Weight Protein Tyrosine Phosphatase (HMWPTP) in the [http://scop.berkeley.edu/sunid=52805 SCOP database]. Compared to the related [[Phosphatase_Family_DSP|DSP]] and [[Phosphatase_Family_PTEN|PTEN]] families, it has an extension to the beta-sheet of 3 antiparallel strands before strand 4. &lt;br /&gt;
&lt;br /&gt;
=== Evolution ===&lt;br /&gt;
PTPs first emerged in holozoa. Among the 17 subfamilies present in human, 6 emerged in holozoa, 5 in metazoa, 3 in eumetazoa, and 3 in chordates or vertebrates. The relationship between the subfamilies is not well understood. The relationships between non-receptor PTPs and those between PTPRN and PTPRR/N5 and other subfamilies, as depicted by tree, are not significantly supported by statistical test; meanwhile, the trees in different studies have different topologies as you can image &amp;lt;cite&amp;gt;Andersen01, Andersen04, Barr09&amp;lt;/cite&amp;gt; (as well as [http://ptp.cshl.edu/proteinclass.shtml PTP website at CSHL]).&lt;br /&gt;
&lt;br /&gt;
=== Subfamilies ===&lt;br /&gt;
The PTPs can be grouped into two classes: receptor PTPs and non-receptor PTPs.&lt;br /&gt;
&lt;br /&gt;
==== Receptor PTPs ====&lt;br /&gt;
Receptor PTPs usually have an extracellular region, a single transmembrane region, and one or two intracytoplasmic catalytic phosphatase domains. Some receptor PTPs encode isoforms without extracellular or transmembrane regions, which function as non-receptor PTPs.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPRA|PTPRA]] is a deuterostome-specific subfamily. Human members are PTPRA (HEPTP/R-PTP-alpha) and PTPRE (R-PTP-EPSILON).&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPRC|PTPRC]] (CD45) is a vertebrate-specific subfamily involved in lymphocyte activation. In particular, it dephosphorylates and activates Src kinases.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPRD|PTPRD]] (LAR) functions in the nervous system. The three human members, PTPRF (LAR), PTPRD (RPTPdelta) and PTPRS (RPTPsigma) dephosphorylate different proteins mostly involved in cell signaling. PTPRD is found in animals and choanoflagellates.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPRG|PTPRG]] is an eumetazoan subfamily that functions in nervous system and maybe cancer. Humans have two members, PTPRG (R-PTP-GAMMA) and PTPRZ1 (RPTPbeta/R-PTP-zeta-2/Rptpζ), which can interact with other PTPs, such as PTPRD.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPRK|PTPRK]] (R2B) is a chordate subfamily that regulates cell-cell adhesion, implicated in human cancer and the nervous system. The four human members are  PTPRK (R-PTP-kappa), PTPRM (PTP mu), PTPRT (RPTPrho), and PTPRU (PTP-RO/hPTP-J/PTP pi/PTP lambda).&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPRB|PTPRB]] (R3) is a metazoan-specific subfamily with functions in the nervous and immune systems. Human has five members: PTPRB (VE-PTP), PTPRH (SAP-1), PTPRJ (CD148/DEP1/RPTP eta), PTPRO (GLEPP1/PTP phi), and PTPRQ. They have distinct substrates. PTPRQ is lipid phosphatase rather than tyrosine phosphatase. &lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPRN|PTPRN]] (IA-2) is a metazoan family involved in neuronal and endocrine vesicle trafficking. No members have shown protein phosphatase activity, but at least one is reported to be a phospholipid phosphatase.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_Ptp69D|Ptp69D]] is a subfamily similar to PTPRD. It is involved in neuronal pathfinding. It emerged in metazoa but is absent from vertebrates.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_CG42327|CG42327]] is found in arthropods. Its function is unclear.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_NvecPTP-sf2|NvecPTP-sf2]] is found in cnidarians, and is of unknown function.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_SpurPTP-sf1|SpurPTP-sf1]], [[Phosphatase_Subfamily_SpurPTP-sf3|SpurPTP-sf3]], [[Phosphatase_Subfamily_SpurPTP-sf4|SpurPTP-sf4]] are found in the sea urchin and have no known functions.&lt;br /&gt;
&lt;br /&gt;
==== Non-receptor PTPs ====&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPN1|PTPN1]] dephosphorylates various families of kinases. It emerged in animals and duplicated in vertebrates. Human has two members, PTPN1 (PTP1B) and PTPN2 (TCPTP).&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPN3|PTPN3]] emerged in holozoa and duplicated in vertebrates. It has a domain combination of FERM domain, PEST sequence, PDZ domain and phosphatase domain. Human has two members of this subfamily, PTPN3 (PTPH1) and PTPN4 (PTPMEG). The expression pattern, substrates and interacting partners of PTPN3 and PTPN4 have limited overlap.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPN6|PTPN6]] (SHP) is implicated in cancer and diabetes. It emerged in holozoa and duplicated in vertebrates. It is characterized by tandem SH2 domains. &lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPN9|PTPN9]] is a metazoan subfamily functions in regulated secretory pathway. It has a characteristic accessory domain, a N-terminal Sec14p homology domain, which localizes it to secretory vesicles.  &lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPN12|PTPN12]] is a cytosolic PTP subfamily emerged in holozoan, duplicated in vertebrates and lost in ecdysozoan. It has a N-terminal phosphatase domain and a C-terminal region containing several proline-rich sequences. Human has three members, PTPN12/PTP-PEST, PTPN18/BDP and PTPN22/LYP. PTPN22/LYP variant R620W is associated with various autoimmune diseases, rheumatoid arthritis (RA), systemic lupus erythematosus (SLE), type 1 diabetes (T1D).&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPN13|PTPN13]] is a cytosolic PTP subfamily that has diverse functions. It has various substrates and interacting partners. PTPN13 has a FERM domain localizing it to plasma membrane, five PDZ domains interacting with different proteins, and a phosphatase domain. PTPN13 probably emerged in holozoan, but lost in various metazoan lineages such as ecdysozoan. PTPN13 has a single member in human: PTPN13/FAP-1/PTP1E/PTPL1/PTP-BAS.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPN14|PTPN14]] (PEZ) is a cytoskeletal-associated phosphatase with roles in cell migration and adhesion, EGFR signaling and regulation of the Hippo pathway. PTPRN14 emerged in metazoa; it is lost in all nematodes and duplicated in vertebrates.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPN20|PTPN20]] is a phosphatase involved in cytoskeleton organization. It emerged in sarcopterygii.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPN23|PTPN23]] (HD-PTP) functions in endosomal protein sorting. It has a signature BRO1 domain that distinguishes it from other protein phosphatases. It is under debate whether PTPN23 is catalytically inactive. PTPN23 emerged in holozoan but absent from some individual lineages, such as sponge and nematode.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_Ptp36E|Ptp36E]] (CG7180) is a ecdysozoan-specific subfamily found in both nematodes and arthropods. Its function is unclear. Interestingly, it has two tandem PTP domains, which is a signature of receptor PTPs, and is similar to PTPRK, but lacks a transmembrane region or signal peptide.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_eak|Eak]] is a nematode-specific subfamily. ''C. elegans'' has two members eak-6 and sdf-9/eak-5 which potentiate AKT-1/PKB signaling. The function seems independent of phosphatase activity, because sdf-9 is predicted to be catalytically inactive given the replacement of cysteine by serine at the Cx5R motif. &lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_egg|Egg]] is a nematode-specific subfamily of pseudophosphatases. ''C. elegans'' has three members  egg-3, egg-4, egg-5. Egg-4/egg-5 binds to the substrate-binding site of the kinase MBK-2 and inhibits the kinase to bind and phoshorylate its substrate, thereby inhibiting downstream signaling.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_ptpB|PtpB]] (a.k.a. [http://dictybase.org/gene/DDB_G0277865 PTP2 in Dictyostelium discoideum]) is a subfamily found in most species in the order of Dictyosteliida (protein domain sequence identify &amp;gt;40%). In the species of Dictyostelium, it regulates MAP kinase ERK1 &amp;lt;cite&amp;gt;Sun11&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_ptpC|PtpC]] (a.k.a. [http://dictybase.org/gene/DDB_G0282145 PTP3 in Dictyostelium discoideum]) is a subfamily found in some species in the order of Dictyosteliida (protein domain sequence identify &amp;gt;70%). In the species of Dictyostelium, it is involved in STAT signaling pathway, downstream of [http://kinase.com/web/current/kinbase/genes/Family/DPYK/ Dictyostelium protein tyrosine kinase] (DPYK) &amp;lt;cite&amp;gt;Sun11&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_MbrePTP-sf1|MbrePTP-sf1]] is one of several clade-specific subfamilies that have no known functions.&lt;br /&gt;
&lt;br /&gt;
=== Phosphatase Domain ===&lt;br /&gt;
The PTP phosphatase domain (PD) has ten motifs &amp;lt;cite&amp;gt;Andersen01&amp;lt;/cite&amp;gt;. The motif 1 (nxxKNRY) is proposed to be pTr-recognition loop. The Y is substituted in i) D2 domain of human receptor PTPs, ii) catalytically inactive PTPs, including PTPRN, PTPN14, and PTPN23, iii) lipid phosphatases PTPRQ and PTPRN2. &lt;br /&gt;
&lt;br /&gt;
==== Second phosphatase domain (D2) ====&lt;br /&gt;
'''PTPRC'''. D2 is necessary for PTPRC (CD45). The loss of D1 PTP activity after the deletion of all or even small portions of the D2 PTP domain &amp;lt;cite&amp;gt; Ng95, Wang00 &amp;lt;/cite&amp;gt;. PTPRC (CD45) has a 19-aa acidic region in D2 domain, which serves as a regulatory module in lymphocyte activation &amp;lt;cite&amp;gt; Wang00 &amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
'''PTPRA'''. The D2 of PTPRA demonstrated higher susceptibility to oxidation &amp;lt;cite&amp;gt;Persson04&amp;lt;/cite&amp;gt;. The oxidation at the cysteine of Cx5R catalytic motif led to inactivation in PTPN1 (PTP1B).&lt;br /&gt;
&lt;br /&gt;
=== References ===&lt;br /&gt;
&amp;lt;biblio&amp;gt;&lt;br /&gt;
#Andersen01 pmid=11585896&lt;br /&gt;
#Andersen04 pmid=14718383&lt;br /&gt;
#Barr09 pmid=19167335&lt;br /&gt;
#Ng95 pmid=7818534&lt;br /&gt;
#Persson04 pmid=14762163&lt;br /&gt;
#Sun11 pmid=21776390&lt;br /&gt;
#Wang00 pmid=10679094&lt;br /&gt;
&amp;lt;/biblio&amp;gt;&lt;/div&gt;</summary>
		<author><name>Mark</name></author>	</entry>

	<entry>
		<id>http://www.phosphatome.net/wiki/index.php/Phosphatase_Family_PTP</id>
		<title>Phosphatase Family PTP</title>
		<link rel="alternate" type="text/html" href="http://www.phosphatome.net/wiki/index.php/Phosphatase_Family_PTP"/>
				<updated>2016-05-10T17:52:09Z</updated>
		
		<summary type="html">&lt;p&gt;Mark: /* Receptor PTPs */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;__NOTOC__&lt;br /&gt;
[[Phosphatase classification|Phosphatase Classification]]: [[Phosphatase_Fold_CC1|Fold CC1]]: [[Phosphatase_Superfamily_CC1|Superfamily CC1]]:  [[Phosphatase_Family_PTP|Family PTP]]&lt;br /&gt;
&lt;br /&gt;
The Protein Tyrosine Phosphatase Family (PTP) is the major tyrosine-specific family of phosphatases, present throughout animals and consisting of both transmembrane receptors (rPTPs) and non-receptor phosphatases (nrPTP), in several distinct subfamilies. This subfamily is known as High Molecular Weight Protein Tyrosine Phosphatase (HMWPTP) in the [http://scop.berkeley.edu/sunid=52805 SCOP database]. Compared to the related [[Phosphatase_Family_DSP|DSP]] and [[Phosphatase_Family_PTEN|PTEN]] families, it has an extension to the beta-sheet of 3 antiparallel strands before strand 4. &lt;br /&gt;
&lt;br /&gt;
=== Evolution ===&lt;br /&gt;
PTPs first emerged in holozoa. Among the 17 subfamilies present in human, 6 emerged in holozoa, 5 in metazoa, 3 in eumetazoa, and 3 in chordates or vertebrates. The relationship between the subfamilies is not well understood. The relationships between non-receptor PTPs and those between PTPRN and PTPRR/N5 and other subfamilies, as depicted by tree, are not significantly supported by statistical test; meanwhile, the trees in different studies have different topologies as you can image &amp;lt;cite&amp;gt;Andersen01, Andersen04, Barr09&amp;lt;/cite&amp;gt; (as well as [http://ptp.cshl.edu/proteinclass.shtml PTP website at CSHL]).&lt;br /&gt;
&lt;br /&gt;
=== Subfamilies ===&lt;br /&gt;
The PTPs can be grouped into two classes: receptor PTPs and non-receptor PTPs.&lt;br /&gt;
&lt;br /&gt;
==== Receptor PTPs ====&lt;br /&gt;
Receptor PTPs usually have an extracellular region, a single transmembrane region, and one or two intracytoplasmic catalytic phosphatase domains. Some receptor PTPs encode isoforms without extracellular or transmembrane regions, which function as non-receptor PTPs.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPRA|PTPRA]] is a deuterostome-specific subfamily. Human members are PTPRA (HEPTP/R-PTP-alpha) and PTPRE (R-PTP-EPSILON).&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPRC|PTPRC]] (CD45) is a vertebrate-specific subfamily involved in lymphocyte activation. In particular, it dephosphorylates and activates Src kinases.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPRD|PTPRD]] (LAR) functions in the nervous system. The three human members, PTPRF (LAR), PTPRD (RPTPdelta) and PTPRS (RPTPsigma) dephosphorylate different proteins mostly involved in cell signaling. PTPRD is found in animals and choanoflagellates.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPRG|PTPRG]] is an eumetazoan subfamily that functions in nervous system and maybe cancer. Humans have two members, PTPRG (R-PTP-GAMMA) and PTPRZ1 (RPTPbeta/R-PTP-zeta-2/Rptpζ), which can interact with other PTPs, such as PTPRD.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPRK|PTPRK]] (R2B) is a chordate subfamily that regulates cell-cell adhesion, implicated in human cancer and the nervous system. The four human members are  PTPRK (R-PTP-kappa), PTPRM (PTP mu), PTPRT (RPTPrho), and PTPRU (PTP-RO/hPTP-J/PTP pi/PTP lambda).&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPRB|PTPRB]] (R3) is a metazoan-specific subfamily with functions in the nervous and immune systems. Human has five members: PTPRB (VE-PTP), PTPRH (SAP-1), PTPRJ (CD148/DEP1/RPTP eta), PTPRO (GLEPP1/PTP phi), and PTPRQ. They have distinct substrates. PTPRQ is lipid phosphatase rather than tyrosine phosphatase. &lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPRN|PTPRN]] (IA-2) is a metazoan family involved in neuronal and endocrine vesicle trafficking. No members have shown protein phosphatase activity, but at least one is reported to be a phospholipid phosphatase.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_Ptp69D|Ptp69D]] is a subfamily similar to PTPRD. It is involved in neuronal pathfinding. It emerged in metazoa but is absent from vertebrates.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_CG42327|CG42327]] is found in arthropods. Its function is unclear.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_NvecPTP-sf2|NvecPTP-sf2]] is found in cnidarians, and is of unknown function.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_SpurPTP-sf1|SpurPTP-sf1]], [[Phosphatase_Subfamily_SpurPTP-sf3|SpurPTP-sf3]], [[Phosphatase_Subfamily_SpurPTP-sf4|SpurPTP-sf4]] are found in the sea urchin and have no known functions.&lt;br /&gt;
&lt;br /&gt;
==== Non-receptor PTPs ====&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPN1|PTPN1]] dephosphorylates various families of kinases. It emerged in animals and duplicated in vertebrates. Human has two members, PTPN1 (PTP1B) and PTPN2 (TCPTP).&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPN3|PTPN3]] emerged in holozoa and duplicated in vertebrates. It has a domain combination of FERM domain, PEST sequence, PDZ domain and phosphatase domain. Human has two members of this subfamily, PTPN3 (PTPH1) and PTPN4 (PTPMEG). The expression pattern, substrates and interacting partners of PTPN3 and PTPN4 have limited overlap.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPN6|PTPN6]] (SHP) is implicated in cancer and diabetes. It emerged in holozoa and duplicated in vertebrates. It is characterized by tandem SH2 domains. &lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPN9|PTPN9]] is a metazoan subfamily functions in regulated secretory pathway. It has a characteristic accessory domain, a N-terminal Sec14p homology domain, which localizes it to secretory vesicles.  &lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPN12|PTPN12]] is a cytosolic PTP subfamily emerged in holozoan, duplicated in vertebrates and lost in ecdysozoan. It has a N-terminal phosphatase domain and a C-terminal region containing several proline-rich sequences. Human has three members, PTPN12/PTP-PEST, PTPN18/BDP and PTPN22/LYP. PTPN22/LYP variant R620W is associated with various autoimmune diseases, rheumatoid arthritis (RA), systemic lupus erythematosus (SLE), type 1 diabetes (T1D).&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPN13|PTPN13]] is a cytosolic PTP subfamily that has diverse functions. It has various substrates and interacting partners. PTPN13 has a FERM domain localizing it to plasma membrane, five PDZ domains interacting with different proteins, and a phosphatase domain. PTPN13 probably emerged in holozoan, but lost in various metazoan lineages such as ecdysozoan. PTPN13 has a single member in human: PTPN13/FAP-1/PTP1E/PTPL1/PTP-BAS.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPN14|PTPN14]] (PEZ) is a cytoskeletal-associated phosphatase with roles in cell migration and adhesion, EGFR signaling and regulation of the Hippo pathway. PTPRN14 emerged in metazoa; it is lost in all nematodes and duplicated in vertebrates.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPN20|PTPN20]] is a phosphatase involved in cytoskeleton organization. It emerged in sarcopterygii.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPN23|PTPN23]] (HD-PTP) functions in endosomal protein sorting. It has a signature BRO1 domain that distinguishes it from other protein phosphatases. It is under debate whether PTPN23 is catalytically inactive. PTPN23 emerged in holozoan but absent from some individual lineages, such as sponge and nematode.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPN5_RR|PTPRR]] (STEP) is a eumetazoan subfamily duplicated in vertebrates but absent from nematodes. . It is characterized by a kinase interaction motif (KIM), which is regulated by the phosphorylation state of a serine within the motif. Human has three members: PTPN5/STEP, PTPN7/HePTP, PTPRR/PTP-SL. They all regulate ERK pathway, but may have their specific substrates. They are expressed in different tissues, particularly, abundant in spleen, thymus, and different parts of brain.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_eak|Eak]] is a nematode-specific subfamily. ''C. elegans'' has two members eak-6 and sdf-9/eak-5 which potentiate AKT-1/PKB signaling. The function seems independent of phosphatase activity, because sdf-9 is predicted to be catalytically inactive given the replacement of cysteine by serine at the Cx5R motif. &lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_egg|Egg]] is a nematode-specific subfamily of pseudophosphatases. ''C. elegans'' has three members  egg-3, egg-4, egg-5. Egg-4/egg-5 binds to the substrate-binding site of the kinase MBK-2 and inhibits the kinase to bind and phoshorylate its substrate, thereby inhibiting downstream signaling.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_ptpB|PtpB]] (a.k.a. [http://dictybase.org/gene/DDB_G0277865 PTP2 in Dictyostelium discoideum]) is a subfamily found in most species in the order of Dictyosteliida (protein domain sequence identify &amp;gt;40%). In the species of Dictyostelium, it regulates MAP kinase ERK1 &amp;lt;cite&amp;gt;Sun11&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_ptpC|PtpC]] (a.k.a. [http://dictybase.org/gene/DDB_G0282145 PTP3 in Dictyostelium discoideum]) is a subfamily found in some species in the order of Dictyosteliida (protein domain sequence identify &amp;gt;70%). In the species of Dictyostelium, it is involved in STAT signaling pathway, downstream of [http://kinase.com/web/current/kinbase/genes/Family/DPYK/ Dictyostelium protein tyrosine kinase] (DPYK) &amp;lt;cite&amp;gt;Sun11&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_MbrePTP-sf1|MbrePTP-sf1]] is one of several clade-specific subfamilies that have no known functions.&lt;br /&gt;
&lt;br /&gt;
=== Phosphatase Domain ===&lt;br /&gt;
The PTP phosphatase domain (PD) has ten motifs &amp;lt;cite&amp;gt;Andersen01&amp;lt;/cite&amp;gt;. The motif 1 (nxxKNRY) is proposed to be pTr-recognition loop. The Y is substituted in i) D2 domain of human receptor PTPs, ii) catalytically inactive PTPs, including PTPRN, PTPN14, and PTPN23, iii) lipid phosphatases PTPRQ and PTPRN2. &lt;br /&gt;
&lt;br /&gt;
==== Second phosphatase domain (D2) ====&lt;br /&gt;
'''PTPRC'''. D2 is necessary for PTPRC (CD45). The loss of D1 PTP activity after the deletion of all or even small portions of the D2 PTP domain &amp;lt;cite&amp;gt; Ng95, Wang00 &amp;lt;/cite&amp;gt;. PTPRC (CD45) has a 19-aa acidic region in D2 domain, which serves as a regulatory module in lymphocyte activation &amp;lt;cite&amp;gt; Wang00 &amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
'''PTPRA'''. The D2 of PTPRA demonstrated higher susceptibility to oxidation &amp;lt;cite&amp;gt;Persson04&amp;lt;/cite&amp;gt;. The oxidation at the cysteine of Cx5R catalytic motif led to inactivation in PTPN1 (PTP1B).&lt;br /&gt;
&lt;br /&gt;
=== References ===&lt;br /&gt;
&amp;lt;biblio&amp;gt;&lt;br /&gt;
#Andersen01 pmid=11585896&lt;br /&gt;
#Andersen04 pmid=14718383&lt;br /&gt;
#Barr09 pmid=19167335&lt;br /&gt;
#Ng95 pmid=7818534&lt;br /&gt;
#Persson04 pmid=14762163&lt;br /&gt;
#Sun11 pmid=21776390&lt;br /&gt;
#Wang00 pmid=10679094&lt;br /&gt;
&amp;lt;/biblio&amp;gt;&lt;/div&gt;</summary>
		<author><name>Mark</name></author>	</entry>

	<entry>
		<id>http://www.phosphatome.net/wiki/index.php/Phosphatase_GeneID_SpurP051</id>
		<title>Phosphatase GeneID SpurP051</title>
		<link rel="alternate" type="text/html" href="http://www.phosphatome.net/wiki/index.php/Phosphatase_GeneID_SpurP051"/>
				<updated>2016-05-10T17:23:40Z</updated>
		
		<summary type="html">&lt;p&gt;Mark: Created page with &amp;quot;Change the classification from PTP-unclassified to SpurPTP-sf1 (date: May 10, 2016).&amp;quot;&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Change the classification from PTP-unclassified to SpurPTP-sf1 (date: May 10, 2016).&lt;/div&gt;</summary>
		<author><name>Mark</name></author>	</entry>

	<entry>
		<id>http://www.phosphatome.net/wiki/index.php/Phosphatase_GeneID_SpurP054</id>
		<title>Phosphatase GeneID SpurP054</title>
		<link rel="alternate" type="text/html" href="http://www.phosphatome.net/wiki/index.php/Phosphatase_GeneID_SpurP054"/>
				<updated>2016-05-10T17:10:06Z</updated>
		
		<summary type="html">&lt;p&gt;Mark: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;A pseudogene probably originates from SpurP111.&lt;br /&gt;
&lt;br /&gt;
Though SpurP054 is fragmentary, it is different from other phosphatases in protein and genomic sequence. The closest sequence is SpurP111, which is 92% identity in protein sequence. By BLATing purple sea urchin genome at UCSC genome browser (assembly Baylor 2.1), it is distinct from SpurP111 in genomic sequence. It is therefore a locus different from SpurP111.&lt;br /&gt;
&lt;br /&gt;
It has a sequence as below:&lt;br /&gt;
&lt;br /&gt;
&amp;gt;Spur_SpurPTP-Un-4 id=SpurP054_AA CC1:CC1:PTP:PTP-unclassified [Strongylocentrotus purpuratus]&lt;br /&gt;
NCSAGVGRTGTFITINCMIEMIEADEKIDVFNFINEMR&lt;br /&gt;
&lt;br /&gt;
But, it can be extended in genomic sequence:&lt;br /&gt;
&lt;br /&gt;
&amp;gt;Extended&lt;br /&gt;
NCSAGVGRTGTFITINCMIEMIEADEKIDVFNFINEMR*RIAFMVQVQVIY&lt;br /&gt;
&lt;br /&gt;
This is now a pseudogene, so I suggest it be classified as a pseudogene and as PTPRB-like.&lt;/div&gt;</summary>
		<author><name>Mark</name></author>	</entry>

	<entry>
		<id>http://www.phosphatome.net/wiki/index.php/Phosphatase_GeneID_SpurP050</id>
		<title>Phosphatase GeneID SpurP050</title>
		<link rel="alternate" type="text/html" href="http://www.phosphatome.net/wiki/index.php/Phosphatase_GeneID_SpurP050"/>
				<updated>2016-05-10T16:50:43Z</updated>
		
		<summary type="html">&lt;p&gt;Mark: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;The entry gene is deleted. See below for the reason.&lt;br /&gt;
&lt;br /&gt;
We have the sequence as:&lt;br /&gt;
&lt;br /&gt;
XRFSISWPRVLPKGTLAGGVNQAGLDYYTNLIDELLANDIEPVVTLYHWDLPQVLQDDYGGWENDSLTDLFNDYANLCFNEYASKVNLWITFNEPYVVTWLGYGIGVFAPGVYSPGYAPYRAAHTIIKAHAKAYNTYRANYFPQYGGKVSITLSTDFGMPEFPDKEVDVAAADRYMQFTAGWFAHPILKNGDYPDVMKWQVGNKSQEQGLSESRLPVFTEEEKQYIKGTGDFFGLNSYTTTVCRHRIEPAGDPNYEGDQMEVLGGCQEPLIPRNGIGRSGVFCALWSVMEKLRKDNTIDIFQAVKRLRSSRPNMVETLDQYQLCYDVMNQHLHQFEEYANLDIL&lt;br /&gt;
&lt;br /&gt;
But, the beginning of this is clearly a non-phosphatase, with good homologs in many organisms, none of which have a phosphatase domain, and have EST coverage. When we trim that off, we get&lt;br /&gt;
&lt;br /&gt;
&amp;gt;Trimmed&lt;br /&gt;
RNGIGRSGVFCALWSVMEKLRKDNTIDIFQAVKRLRSSRPNMVETLDQYQLCYDVMNQHLHQFEEYANLDIL&lt;br /&gt;
&lt;br /&gt;
This sequence is identical over 45 AA to SpurP102, so this is no longer a unique gene and can be deleted from the phosphatome. Since SpurP102 is at the end of a contig, our guess is that this contig overlaps with the P050 one that then extends a little, but it really is just one gene.&lt;/div&gt;</summary>
		<author><name>Mark</name></author>	</entry>

	<entry>
		<id>http://www.phosphatome.net/wiki/index.php/Phosphatase_GeneID_SpurP050</id>
		<title>Phosphatase GeneID SpurP050</title>
		<link rel="alternate" type="text/html" href="http://www.phosphatome.net/wiki/index.php/Phosphatase_GeneID_SpurP050"/>
				<updated>2016-05-10T16:48:35Z</updated>
		
		<summary type="html">&lt;p&gt;Mark: Created page with &amp;quot;We have the sequence as:  XRFSISWPRVLPKGTLAGGVNQAGLDYYTNLIDELLANDIEPVVTLYHWDLPQVLQDDYGGWENDSLTDLFNDYANLCFNEYASKVNLWITFNEPYVVTWLGYGIGVFAPGVYSPGYAPYRAAHTIIKAHAKAYNTYRANYFPQYGGKV...&amp;quot;&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;We have the sequence as:&lt;br /&gt;
&lt;br /&gt;
XRFSISWPRVLPKGTLAGGVNQAGLDYYTNLIDELLANDIEPVVTLYHWDLPQVLQDDYGGWENDSLTDLFNDYANLCFNEYASKVNLWITFNEPYVVTWLGYGIGVFAPGVYSPGYAPYRAAHTIIKAHAKAYNTYRANYFPQYGGKVSITLSTDFGMPEFPDKEVDVAAADRYMQFTAGWFAHPILKNGDYPDVMKWQVGNKSQEQGLSESRLPVFTEEEKQYIKGTGDFFGLNSYTTTVCRHRIEPAGDPNYEGDQMEVLGGCQEPLIPRNGIGRSGVFCALWSVMEKLRKDNTIDIFQAVKRLRSSRPNMVETLDQYQLCYDVMNQHLHQFEEYANLDIL&lt;br /&gt;
&lt;br /&gt;
But, the beginning of this is clearly a non-phosphatase, with good homologs in many organisms, none of which have a phosphatase domain, and have EST coverage. When we trim that off, we get&lt;br /&gt;
&lt;br /&gt;
&amp;gt;Trimmed&lt;br /&gt;
RNGIGRSGVFCALWSVMEKLRKDNTIDIFQAVKRLRSSRPNMVETLDQYQLCYDVMNQHLHQFEEYANLDIL&lt;br /&gt;
&lt;br /&gt;
This sequence is identical over 45 AA to SpurP102, so this is no longer a unique gene and can be deleted from the phosphatome. Since SpurP102 is at the end of a contig, our guess is that this contig overlaps with the P050 one that then extends a little, but it really is just one gene.&lt;/div&gt;</summary>
		<author><name>Mark</name></author>	</entry>

	<entry>
		<id>http://www.phosphatome.net/wiki/index.php/Phosphatase_Family_PTP</id>
		<title>Phosphatase Family PTP</title>
		<link rel="alternate" type="text/html" href="http://www.phosphatome.net/wiki/index.php/Phosphatase_Family_PTP"/>
				<updated>2016-05-08T20:24:37Z</updated>
		
		<summary type="html">&lt;p&gt;Mark: /* Receptor PTPs */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;__NOTOC__&lt;br /&gt;
[[Phosphatase classification|Phosphatase Classification]]: [[Phosphatase_Fold_CC1|Fold CC1]]: [[Phosphatase_Superfamily_CC1|Superfamily CC1]]:  [[Phosphatase_Family_PTP|Family PTP]]&lt;br /&gt;
&lt;br /&gt;
The Protein Tyrosine Phosphatase Family (PTP) is the major tyrosine-specific family of phosphatases, present throughout animals and consisting of both transmembrane receptors (rPTPs) and non-receptor phosphatases (nrPTP), in several distinct subfamilies. This subfamily is known as High Molecular Weight Protein Tyrosine Phosphatase (HMWPTP) in the [http://scop.berkeley.edu/sunid=52805 SCOP database]. Compared to the related [[Phosphatase_Family_DSP|DSP]] and [[Phosphatase_Family_PTEN|PTEN]] families, it has an extension to the beta-sheet of 3 antiparallel strands before strand 4. &lt;br /&gt;
&lt;br /&gt;
=== Evolution ===&lt;br /&gt;
PTPs first emerged in holozoa. Among the 17 subfamilies present in human, 6 emerged in holozoa, 5 in metazoa, 3 in eumetazoa, and 3 in chordates or vertebrates. The relationship between the subfamilies is not well understood. The relationships between non-receptor PTPs and those between PTPRN and PTPRR/N5 and other subfamilies, as depicted by tree, are not significantly supported by statistical test; meanwhile, the trees in different studies have different topologies as you can image &amp;lt;cite&amp;gt;Andersen01, Andersen04, Barr09&amp;lt;/cite&amp;gt; (as well as [http://ptp.cshl.edu/proteinclass.shtml PTP website at CSHL]).&lt;br /&gt;
&lt;br /&gt;
=== Subfamilies ===&lt;br /&gt;
The PTPs can be grouped into two classes: receptor PTPs and non-receptor PTPs.&lt;br /&gt;
&lt;br /&gt;
==== Receptor PTPs ====&lt;br /&gt;
Receptor PTPs usually have an extracellular region, a single transmembrane region, and one or two intracytoplasmic catalytic phosphatase domains. Some receptor PTPs encode isoforms without extracellular or transmembrane regions, which function as non-receptor PTPs.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPRA|PTPRA]] is a deuterostome-specific subfamily. Human members are PTPRA (HEPTP/R-PTP-alpha) and PTPRE (R-PTP-EPSILON).&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPRC|PTPRC]] (CD45) is a vertebrate-specific subfamily involved in lymphocyte activation. In particular, it dephosphorylates and activates Src kinases.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPRD|PTPRD]] (LAR) is a subfamily that functions in the nervous system. The three human members, PTPRF (LAR), PTPRD (RPTPdelta) and PTPRS (RPTPsigma) dephoshorylate different proteins mostly involved in cell signaling. PTPRD is found in animals and choanoflagellates.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPRG|PTPRG]] is an eumetazoan subfamily functions in nervous system and maybe cancer. Human has two members, PTPRG (R-PTP-GAMMA) and PTPRZ1 (RPTPbeta/R-PTP-zeta-2/Rptpζ), which can interact with other PTPs, such as PTPRD.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPRK|PTPRK]] (R2B) is a chordate subfamily that regulates cell-cell adhesion, implicated in human cancer and nervous system. Human has four members, PTPRK (R-PTP-kappa), PTPRM (PTP mu), PTPRT (RPTPrho), and PTPRU (PTP-RO/hPTP-J/PTP pi/PTP lambda).&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPRB|PTPRB]] (R3) is a metazoan-specific subfamily with functions in the nervous and immune systems. Human has five members: PTPRB (VE-PTP), PTPRH (SAP-1), PTPRJ (CD148/DEP1/RPTP eta), PTPRO (GLEPP1/PTP phi), and PTPRQ. They have distinct substrates. One particular interesting example is that PTPRQ is lipid phosphatase rather than tyrosine phosphatase. &lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPRN|PTPRN]] (IA-2) is a metazoan family involved in neuronal and endocrine vesicle trafficking. No members have shown protein phosphatase activity, but at least one is reported to be a phospholipid phosphatase.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_Ptp69D|Ptp69D]] is a subfamily similar to PTPRD. It involved in neuronal pathfinding. It emerged in metazoa but absent from vertebrates.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_Ptp36E|Ptp36E]] (CG7180) is a ecdysozoan-specific subfamily found in both nematodes and arthropods. Its function is unclear. Interestingly, it has two tandem PTP domains, which is a signature of receptor PTPs, and is similar to PTPRK. However, we do not find transmembrane region or signal peptide.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_CG42327|CG42327]] is found in arthropods. Its function is unclear.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_NvecPTP-sf2|NvecPTP-sf2]] is found in Cnidarians, and is of unknown function.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_SpurPTP-sf1|SpurPTP-sf1]], [[Phosphatase_Subfamily_SpurPTP-sf3|SpurPTP-sf3]], [[Phosphatase_Subfamily_SpurPTP-sf4|SpurPTP-sf4]] are found in the sea urchin and have no known functions.&lt;br /&gt;
&lt;br /&gt;
==== Non-receptor PTPs ====&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPN1|PTPN1]] dephosphorylates various families of kinases. It emerged in animals and duplicated in vertebrates. Human has two members, PTPN1 (PTP1B) and PTPN2 (TCPTP).&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPN3|PTPN3]] emerged in holozoa and duplicated in vertebrates. It has a domain combination of FERM domain, PEST sequence, PDZ domain and phosphatase domain. Human has two members of this subfamily, PTPN3 (PTPH1) and PTPN4 (PTPMEG). The expression pattern, substrates and interacting partners of PTPN3 and PTPN4 have limited overlap.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPN6|PTPN6]] (SHP) is implicated in cancer and diabetes. It emerged in holozoa and duplicated in vertebrates. It is characterized by tandem SH2 domains. &lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPN9|PTPN9]] is a metazoan subfamily functions in regulated secretory pathway. It has a characteristic accessory domain, a N-terminal Sec14p homology domain, which localizes it to secretory vesicles.  &lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPN12|PTPN12]] is a cytosolic PTP subfamily emerged in holozoan, duplicated in vertebrates and lost in ecdysozoan. It has a N-terminal phosphatase domain and a C-terminal region containing several proline-rich sequences. Human has three members, PTPN12/PTP-PEST, PTPN18/BDP and PTPN22/LYP. PTPN22/LYP variant R620W is associated with various autoimmune diseases, rheumatoid arthritis (RA), systemic lupus erythematosus (SLE), type 1 diabetes (T1D).&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPN13|PTPN13]] is a cytosolic PTP subfamily that has diverse functions. It has various substrates and interacting partners. PTPN13 has a FERM domain localizing it to plasma membrane, five PDZ domains interacting with different proteins, and a phosphatase domain. PTPN13 probably emerged in holozoan, but lost in various metazoan lineages such as ecdysozoan. PTPN13 has a single member in human: PTPN13/FAP-1/PTP1E/PTPL1/PTP-BAS.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPN14|PTPN14]] (PEZ) is a cytoskeletal-associated phosphatase with roles in cell migration and adhesion, EGFR signaling and regulation of the Hippo pathway. PTPRN14 emerged in metazoa; it is lost in all nematodes and duplicated in vertebrates.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPN20|PTPN20]] is a phosphatase involved in cytoskeleton organization. It emerged in sarcopterygii.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPN23|PTPN23]] (HD-PTP) functions in endosomal protein sorting. It has a signature BRO1 domain that distinguishes it from other protein phosphatases. It is under debate whether PTPN23 is catalytically inactive. PTPN23 emerged in holozoan but absent from some individual lineages, such as sponge and nematode.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPN5_RR|PTPRR]] (STEP) is a eumetazoan subfamily duplicated in vertebrates but absent from nematodes. . It is characterized by a kinase interaction motif (KIM), which is regulated by the phosphorylation state of a serine within the motif. Human has three members: PTPN5/STEP, PTPN7/HePTP, PTPRR/PTP-SL. They all regulate ERK pathway, but may have their specific substrates. They are expressed in different tissues, particularly, abundant in spleen, thymus, and different parts of brain.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_eak|Eak]] is a nematode-specific subfamily. ''C. elegans'' has two members eak-6 and sdf-9/eak-5 which potentiate AKT-1/PKB signaling. The function seems independent of phosphatase activity, because sdf-9 is predicted to be catalytically inactive given the replacement of cysteine by serine at the Cx5R motif. &lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_egg|Egg]] is a nematode-specific subfamily of pseudophosphatases. ''C. elegans'' has three members  egg-3, egg-4, egg-5. Egg-4/egg-5 binds to the substrate-binding site of the kinase MBK-2 and inhibits the kinase to bind and phoshorylate its substrate, thereby inhibiting downstream signaling.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_ptpB|PtpB]] (a.k.a. [http://dictybase.org/gene/DDB_G0277865 PTP2 in Dictyostelium discoideum]) is a subfamily found in most species in the order of Dictyosteliida (protein domain sequence identify &amp;gt;40%). In the species of Dictyostelium, it regulates MAP kinase ERK1 &amp;lt;cite&amp;gt;Sun11&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_ptpC|PtpC]] (a.k.a. [http://dictybase.org/gene/DDB_G0282145 PTP3 in Dictyostelium discoideum]) is a subfamily found in some species in the order of Dictyosteliida (protein domain sequence identify &amp;gt;70%). In the species of Dictyostelium, it is involved in STAT signaling pathway, downstream of [http://kinase.com/web/current/kinbase/genes/Family/DPYK/ Dictyostelium protein tyrosine kinase] (DPYK) &amp;lt;cite&amp;gt;Sun11&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_MbrePTP-sf1|MbrePTP-sf1]] is one of several clade-specific subfamilies that have no known functions.&lt;br /&gt;
&lt;br /&gt;
=== Phosphatase Domain ===&lt;br /&gt;
The PTP phosphatase domain (PD) has ten motifs &amp;lt;cite&amp;gt;Andersen01&amp;lt;/cite&amp;gt;. The motif 1 (nxxKNRY) is proposed to be pTr-recognition loop. The Y is substituted in i) D2 domain of human receptor PTPs, ii) catalytically inactive PTPs, including PTPRN, PTPN14, and PTPN23, iii) lipid phosphatases PTPRQ and PTPRN2. &lt;br /&gt;
&lt;br /&gt;
==== Second phosphatase domain (D2) ====&lt;br /&gt;
'''PTPRC'''. D2 is necessary for PTPRC (CD45). The loss of D1 PTP activity after the deletion of all or even small portions of the D2 PTP domain &amp;lt;cite&amp;gt; Ng95, Wang00 &amp;lt;/cite&amp;gt;. PTPRC (CD45) has a 19-aa acidic region in D2 domain, which serves as a regulatory module in lymphocyte activation &amp;lt;cite&amp;gt; Wang00 &amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
'''PTPRA'''. The D2 of PTPRA demonstrated higher susceptibility to oxidation &amp;lt;cite&amp;gt;Persson04&amp;lt;/cite&amp;gt;. The oxidation at the cysteine of Cx5R catalytic motif led to inactivation in PTPN1 (PTP1B).&lt;br /&gt;
&lt;br /&gt;
=== References ===&lt;br /&gt;
&amp;lt;biblio&amp;gt;&lt;br /&gt;
#Andersen01 pmid=11585896&lt;br /&gt;
#Andersen04 pmid=14718383&lt;br /&gt;
#Barr09 pmid=19167335&lt;br /&gt;
#Ng95 pmid=7818534&lt;br /&gt;
#Persson04 pmid=14762163&lt;br /&gt;
#Sun11 pmid=21776390&lt;br /&gt;
#Wang00 pmid=10679094&lt;br /&gt;
&amp;lt;/biblio&amp;gt;&lt;/div&gt;</summary>
		<author><name>Mark</name></author>	</entry>

	<entry>
		<id>http://www.phosphatome.net/wiki/index.php/Phosphatase_Family_PTP</id>
		<title>Phosphatase Family PTP</title>
		<link rel="alternate" type="text/html" href="http://www.phosphatome.net/wiki/index.php/Phosphatase_Family_PTP"/>
				<updated>2016-05-08T20:22:56Z</updated>
		
		<summary type="html">&lt;p&gt;Mark: /* Non-receptor PTPs */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;__NOTOC__&lt;br /&gt;
[[Phosphatase classification|Phosphatase Classification]]: [[Phosphatase_Fold_CC1|Fold CC1]]: [[Phosphatase_Superfamily_CC1|Superfamily CC1]]:  [[Phosphatase_Family_PTP|Family PTP]]&lt;br /&gt;
&lt;br /&gt;
The Protein Tyrosine Phosphatase Family (PTP) is the major tyrosine-specific family of phosphatases, present throughout animals and consisting of both transmembrane receptors (rPTPs) and non-receptor phosphatases (nrPTP), in several distinct subfamilies. This subfamily is known as High Molecular Weight Protein Tyrosine Phosphatase (HMWPTP) in the [http://scop.berkeley.edu/sunid=52805 SCOP database]. Compared to the related [[Phosphatase_Family_DSP|DSP]] and [[Phosphatase_Family_PTEN|PTEN]] families, it has an extension to the beta-sheet of 3 antiparallel strands before strand 4. &lt;br /&gt;
&lt;br /&gt;
=== Evolution ===&lt;br /&gt;
PTPs first emerged in holozoa. Among the 17 subfamilies present in human, 6 emerged in holozoa, 5 in metazoa, 3 in eumetazoa, and 3 in chordates or vertebrates. The relationship between the subfamilies is not well understood. The relationships between non-receptor PTPs and those between PTPRN and PTPRR/N5 and other subfamilies, as depicted by tree, are not significantly supported by statistical test; meanwhile, the trees in different studies have different topologies as you can image &amp;lt;cite&amp;gt;Andersen01, Andersen04, Barr09&amp;lt;/cite&amp;gt; (as well as [http://ptp.cshl.edu/proteinclass.shtml PTP website at CSHL]).&lt;br /&gt;
&lt;br /&gt;
=== Subfamilies ===&lt;br /&gt;
The PTPs can be grouped into two classes: receptor PTPs and non-receptor PTPs.&lt;br /&gt;
&lt;br /&gt;
==== Receptor PTPs ====&lt;br /&gt;
Receptor PTPs usually have an extracellular region, a single transmembrane region, and one or two intracytoplasmic catalytic phosphatase domains. Some receptor PTPs encode isoforms without extracellular or transmembrane regions, which function as non-receptor PTPs.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPRA|PTPRA]] is a deuterostome-specific subfamily. Human members are PTPRA (HEPTP/R-PTP-alpha) and PTPRE (R-PTP-EPSILON).&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPRC|PTPRC]] (CD45) is a vertebrate-specific subfamily involved in lymphocyte activation. In particular, it dephosphorylates and activates Src kinases.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPRD|PTPRD]] (LAR) is a subfamily that functions in the nervous system. The three human members, PTPRF (LAR), PTPRD (RPTPdelta) and PTPRS (RPTPsigma) dephoshorylate different proteins mostly involved in cell signaling. PTPRD is found in animals and choanoflagellates.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPRG|PTPRG]] is an eumetazoan subfamily functions in nervous system and maybe cancer. Human has two members, PTPRG (R-PTP-GAMMA) and PTPRZ1 (RPTPbeta/R-PTP-zeta-2/Rptpζ), which can interact with other PTPs, such as PTPRD.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPRK|PTPRK]] (R2B) is a chordate subfamily that regulates cell-cell adhesion, implicated in human cancer and nervous system. Human has four members, PTPRK (R-PTP-kappa), PTPRM (PTP mu), PTPRT (RPTPrho), and PTPRU (PTP-RO/hPTP-J/PTP pi/PTP lambda).&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPRB|PTPRB]] (R3) is a metazoan-specific subfamily with functions in the nervous and immune systems. Human has five members: PTPRB (VE-PTP), PTPRH (SAP-1), PTPRJ (CD148/DEP1/RPTP eta), PTPRO (GLEPP1/PTP phi), and PTPRQ. They have distinct substrates. One particular interesting example is that PTPRQ is lipid phosphatase rather than tyrosine phosphatase. &lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPRN|PTPRN]] (IA-2) is a metazoan family involved in neuronal and endocrine vesicle trafficking. No members have shown protein phosphatase activity, but at least one is reported to be a phospholipid phosphatase.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_Ptp69D|Ptp69D]] is a subfamily similar to PTPRD. It involved in neuronal pathfinding. It emerged in metazoa but absent from vertebrates.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_CG42327|CG42327]] is found in arthropods. Its function is unclear.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_NvecPTP-sf2|NvecPTP-sf2]] is found in Cnidarians, and is of unknown function.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_SpurPTP-sf1|SpurPTP-sf1]], [[Phosphatase_Subfamily_SpurPTP-sf3|SpurPTP-sf3]], [[Phosphatase_Subfamily_SpurPTP-sf4|SpurPTP-sf4]] are found in the sea urchin and have no known functions.&lt;br /&gt;
&lt;br /&gt;
==== Non-receptor PTPs ====&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPN1|PTPN1]] dephosphorylates various families of kinases. It emerged in animals and duplicated in vertebrates. Human has two members, PTPN1 (PTP1B) and PTPN2 (TCPTP).&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPN3|PTPN3]] emerged in holozoa and duplicated in vertebrates. It has a domain combination of FERM domain, PEST sequence, PDZ domain and phosphatase domain. Human has two members of this subfamily, PTPN3 (PTPH1) and PTPN4 (PTPMEG). The expression pattern, substrates and interacting partners of PTPN3 and PTPN4 have limited overlap.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPN6|PTPN6]] (SHP) is implicated in cancer and diabetes. It emerged in holozoa and duplicated in vertebrates. It is characterized by tandem SH2 domains. &lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPN9|PTPN9]] is a metazoan subfamily functions in regulated secretory pathway. It has a characteristic accessory domain, a N-terminal Sec14p homology domain, which localizes it to secretory vesicles.  &lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPN12|PTPN12]] is a cytosolic PTP subfamily emerged in holozoan, duplicated in vertebrates and lost in ecdysozoan. It has a N-terminal phosphatase domain and a C-terminal region containing several proline-rich sequences. Human has three members, PTPN12/PTP-PEST, PTPN18/BDP and PTPN22/LYP. PTPN22/LYP variant R620W is associated with various autoimmune diseases, rheumatoid arthritis (RA), systemic lupus erythematosus (SLE), type 1 diabetes (T1D).&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPN13|PTPN13]] is a cytosolic PTP subfamily that has diverse functions. It has various substrates and interacting partners. PTPN13 has a FERM domain localizing it to plasma membrane, five PDZ domains interacting with different proteins, and a phosphatase domain. PTPN13 probably emerged in holozoan, but lost in various metazoan lineages such as ecdysozoan. PTPN13 has a single member in human: PTPN13/FAP-1/PTP1E/PTPL1/PTP-BAS.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPN14|PTPN14]] (PEZ) is a cytoskeletal-associated phosphatase with roles in cell migration and adhesion, EGFR signaling and regulation of the Hippo pathway. PTPRN14 emerged in metazoa; it is lost in all nematodes and duplicated in vertebrates.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPN20|PTPN20]] is a phosphatase involved in cytoskeleton organization. It emerged in sarcopterygii.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPN23|PTPN23]] (HD-PTP) functions in endosomal protein sorting. It has a signature BRO1 domain that distinguishes it from other protein phosphatases. It is under debate whether PTPN23 is catalytically inactive. PTPN23 emerged in holozoan but absent from some individual lineages, such as sponge and nematode.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_PTPN5_RR|PTPRR]] (STEP) is a eumetazoan subfamily duplicated in vertebrates but absent from nematodes. . It is characterized by a kinase interaction motif (KIM), which is regulated by the phosphorylation state of a serine within the motif. Human has three members: PTPN5/STEP, PTPN7/HePTP, PTPRR/PTP-SL. They all regulate ERK pathway, but may have their specific substrates. They are expressed in different tissues, particularly, abundant in spleen, thymus, and different parts of brain.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_eak|Eak]] is a nematode-specific subfamily. ''C. elegans'' has two members eak-6 and sdf-9/eak-5 which potentiate AKT-1/PKB signaling. The function seems independent of phosphatase activity, because sdf-9 is predicted to be catalytically inactive given the replacement of cysteine by serine at the Cx5R motif. &lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_egg|Egg]] is a nematode-specific subfamily of pseudophosphatases. ''C. elegans'' has three members  egg-3, egg-4, egg-5. Egg-4/egg-5 binds to the substrate-binding site of the kinase MBK-2 and inhibits the kinase to bind and phoshorylate its substrate, thereby inhibiting downstream signaling.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_ptpB|PtpB]] (a.k.a. [http://dictybase.org/gene/DDB_G0277865 PTP2 in Dictyostelium discoideum]) is a subfamily found in most species in the order of Dictyosteliida (protein domain sequence identify &amp;gt;40%). In the species of Dictyostelium, it regulates MAP kinase ERK1 &amp;lt;cite&amp;gt;Sun11&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_ptpC|PtpC]] (a.k.a. [http://dictybase.org/gene/DDB_G0282145 PTP3 in Dictyostelium discoideum]) is a subfamily found in some species in the order of Dictyosteliida (protein domain sequence identify &amp;gt;70%). In the species of Dictyostelium, it is involved in STAT signaling pathway, downstream of [http://kinase.com/web/current/kinbase/genes/Family/DPYK/ Dictyostelium protein tyrosine kinase] (DPYK) &amp;lt;cite&amp;gt;Sun11&amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
* [[Phosphatase_Subfamily_MbrePTP-sf1|MbrePTP-sf1]] is one of several clade-specific subfamilies that have no known functions.&lt;br /&gt;
&lt;br /&gt;
=== Phosphatase Domain ===&lt;br /&gt;
The PTP phosphatase domain (PD) has ten motifs &amp;lt;cite&amp;gt;Andersen01&amp;lt;/cite&amp;gt;. The motif 1 (nxxKNRY) is proposed to be pTr-recognition loop. The Y is substituted in i) D2 domain of human receptor PTPs, ii) catalytically inactive PTPs, including PTPRN, PTPN14, and PTPN23, iii) lipid phosphatases PTPRQ and PTPRN2. &lt;br /&gt;
&lt;br /&gt;
==== Second phosphatase domain (D2) ====&lt;br /&gt;
'''PTPRC'''. D2 is necessary for PTPRC (CD45). The loss of D1 PTP activity after the deletion of all or even small portions of the D2 PTP domain &amp;lt;cite&amp;gt; Ng95, Wang00 &amp;lt;/cite&amp;gt;. PTPRC (CD45) has a 19-aa acidic region in D2 domain, which serves as a regulatory module in lymphocyte activation &amp;lt;cite&amp;gt; Wang00 &amp;lt;/cite&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
'''PTPRA'''. The D2 of PTPRA demonstrated higher susceptibility to oxidation &amp;lt;cite&amp;gt;Persson04&amp;lt;/cite&amp;gt;. The oxidation at the cysteine of Cx5R catalytic motif led to inactivation in PTPN1 (PTP1B).&lt;br /&gt;
&lt;br /&gt;
=== References ===&lt;br /&gt;
&amp;lt;biblio&amp;gt;&lt;br /&gt;
#Andersen01 pmid=11585896&lt;br /&gt;
#Andersen04 pmid=14718383&lt;br /&gt;
#Barr09 pmid=19167335&lt;br /&gt;
#Ng95 pmid=7818534&lt;br /&gt;
#Persson04 pmid=14762163&lt;br /&gt;
#Sun11 pmid=21776390&lt;br /&gt;
#Wang00 pmid=10679094&lt;br /&gt;
&amp;lt;/biblio&amp;gt;&lt;/div&gt;</summary>
		<author><name>Mark</name></author>	</entry>

	<entry>
		<id>http://www.phosphatome.net/wiki/index.php/Phosphatase_GeneID_CeleP222</id>
		<title>Phosphatase GeneID CeleP222</title>
		<link rel="alternate" type="text/html" href="http://www.phosphatome.net/wiki/index.php/Phosphatase_GeneID_CeleP222"/>
				<updated>2016-05-08T20:16:52Z</updated>
		
		<summary type="html">&lt;p&gt;Mark: Created page with &amp;quot;It is predicted to be receptor PTP based upon the presence of signal peptide predicted by SignalP.&amp;quot;&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;It is predicted to be receptor PTP based upon the presence of signal peptide predicted by SignalP.&lt;/div&gt;</summary>
		<author><name>Mark</name></author>	</entry>

	<entry>
		<id>http://www.phosphatome.net/wiki/index.php/Phosphatase_GeneID_AqueP047</id>
		<title>Phosphatase GeneID AqueP047</title>
		<link rel="alternate" type="text/html" href="http://www.phosphatome.net/wiki/index.php/Phosphatase_GeneID_AqueP047"/>
				<updated>2016-05-08T20:13:48Z</updated>
		
		<summary type="html">&lt;p&gt;Mark: Created page with &amp;quot;It is predicted to be receptor PTP based upon the presence of signal peptide predicted by SignalP.&amp;quot;&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;It is predicted to be receptor PTP based upon the presence of signal peptide predicted by SignalP.&lt;/div&gt;</summary>
		<author><name>Mark</name></author>	</entry>

	</feed>